[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63209.1
DDBJ      :             conserved protein with 2 CBS domains
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  303/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:127 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   24->124 2ef7B PDBj 7e-18 46.9 %
:RPS:PDB   1->121 2d4zA PDBj 4e-18 12.4 %
:RPS:SCOP  3->120 2ef7A1  d.37.1.1 * 7e-24 41.0 %
:HMM:SCOP  1->60 2nycA1 d.37.1.1 * 1.7e-12 31.7 %
:HMM:SCOP  63->122 2o16A2 d.37.1.1 * 9.5e-14 41.7 %
:RPS:PFM   73->118 PF00571 * CBS 1e-04 37.0 %
:HMM:PFM   3->58 PF00571 * CBS 5.4e-16 32.1 56/57  
:HMM:PFM   68->121 PF00571 * CBS 8.5e-19 37.0 54/57  
:BLT:SWISS 3->126 Y1225_METJA 4e-17 29.8 %
:REPEAT 2|3->57|67->120

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63209.1 GT:GENE AAL63209.1 GT:PRODUCT conserved protein with 2 CBS domains GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(601212..601595) GB:FROM 601212 GB:TO 601595 GB:DIRECTION - GB:PRODUCT conserved protein with 2 CBS domains GB:NOTE Unclassified GB:PROTEIN_ID AAL63209.1 GB:DB_XREF GI:18159810 LENGTH 127 SQ:AASEQ MKVRDLLKDNVIFCYADEPVECAVAKMYAANVGSVVVMDRANRPVGIVTERDIVRFLAQEIDLKTPLEQVAKKSLITVSPEESIVSAAAKMIENNIRHMPVVEGGRVVGVISIRDVLRALVTAEAFP GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 3->126|Y1225_METJA|4e-17|29.8|124/280| NREPEAT 1 REPEAT 2|3->57|67->120| BL:PDB:NREP 1 BL:PDB:REP 24->124|2ef7B|7e-18|46.9|98/120| RP:PDB:NREP 1 RP:PDB:REP 1->121|2d4zA|4e-18|12.4|121/169| RP:PFM:NREP 1 RP:PFM:REP 73->118|PF00571|1e-04|37.0|46/56|CBS| HM:PFM:NREP 2 HM:PFM:REP 3->58|PF00571|5.4e-16|32.1|56/57|CBS| HM:PFM:REP 68->121|PF00571|8.5e-19|37.0|54/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 3->120|2ef7A1|7e-24|41.0|117/127|d.37.1.1| HM:SCP:REP 1->60|2nycA1|1.7e-12|31.7|60/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 63->122|2o16A2|9.5e-14|41.7|60/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 693 OP:NHOMOORG 375 OP:PATTERN 442425866545454613B8BA932-11-1-2--34412424512-334-232311-211-1--4--3 -1--11-------1-------1--11-----12---12111212-1--------------121--2221----------------123-------------1--22----------------------------1132221----1---------------------11--------------11-11---1312222232232223221333-1222221----------1-------------------------------------------------------------------------------------------1111233332331311-11-----11--1--4211-1--212----1---11-1111------11331-11121111-11111-11-12111-1---1-----2--1--1122-112112222-23--------1----411--------------11--------------21-1-11111222222322222232222212223-2-1111111111111122112111-111-------1-1321----1----4-11-------1-----2--1-1-----------------------1---11--3--1--12-----311--12--1121----2-2--------------------------------------------------------------------------------------------------22111-311---------------------1---11--1-2222322221111----------112111111---1-22-1111111------1-111111------------------------------------------1----1- ----11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---3---2-3214-21121111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 98.4 SQ:SECSTR ccTTcccccccccEETTccHHHHHHHHHHccccEEEEEccTTcEEEEEEHHHHHHHHHHHHccccTTcccEEcccccccTTccHHHHHHHHHHHTccEEEEEETTEEEEEEEHHHHHHHHHTccc## PSIPRED ccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHHHccc //