[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63228.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->106 2a61A PDBj 7e-04 22.4 %
:HMM:PFM   1->59 PF02082 * Rrf2 0.0009 18.6 59/83  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63228.1 GT:GENE AAL63228.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(618699..619403) GB:FROM 618699 GB:TO 619403 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63228.1 GB:DB_XREF GI:18159831 LENGTH 234 SQ:AASEQ MRLTPAQRLVLYYMAFEVVYHGKTWFTFEDLKRGTGLAVRTLRAALVSLRKQGYIESYMLPSQGRRLLHRLKIEKLIPEPELQGLYLVDVAGDVLTPDAVSVISRVDVVLYTENVPIKKIEGLAKRLEPYKGEVPEASSVAIVFNSLLDWERVAGLAPRARYICASNALDKAIGVCLTCGDVDLDLRTIRIKSPGADIGNLLDSYDIVGTITVDGCGGRKAELLVLKKRELKSK GT:EXON 1|1-234:0| RP:PDB:NREP 1 RP:PDB:REP 3->106|2a61A|7e-04|22.4|98/142| HM:PFM:NREP 1 HM:PFM:REP 1->59|PF02082|0.0009|18.6|59/83|Rrf2| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -----------------121111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 41.9 SQ:SECSTR ##ccHHHHHHHHHHHHH######ccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHH################################################################################################################################ DISOP:02AL 1-4, 232-234| PSIPRED cccccHHHHHHHHHHHHHEEccccEEEHHHHHHHccccHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHcccHHHccEEEEEEccHHHcHHHHHHHHHEEEEEEccccccHHHHHHEEEccccHHHHHHHcEEEEEEEccHHHEEcccccccHHEEEccHHHHHHHEEEEEEccccEEEEEEEEEccccHHHHHHHcccEEEEEEEEccccccEEEEEEEcHHcccc //