[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63235.1
DDBJ      :             P. aerophilum family 3 protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63235.1 GT:GENE AAL63235.1 GT:PRODUCT P. aerophilum family 3 protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 626870..627409 GB:FROM 626870 GB:TO 627409 GB:DIRECTION + GB:PRODUCT P. aerophilum family 3 protein GB:NOTE Hypothetical; Conserved within genome GB:PROTEIN_ID AAL63235.1 GB:DB_XREF GI:18159838 LENGTH 179 SQ:AASEQ MLTVLDKARNFLLFSLLFSLFTYIVYYWGGGVWRTALYAVGFFSFYAAYFDGLRGRPRWTLLYFAAYLVAYMGVHFGFARAVVHVLMATMLFGPLLYGNGVGRLASLAFFWLGAVTSAVVVNGLGRLYRMAVPPAYDVLPTALPSPYDAPLYLLGYIVLWQIHCISHRWGGEIRCPKWR GT:EXON 1|1-179:0| TM:NTM 4 TM:REGION 9->31| TM:REGION 67->89| TM:REGION 104->126| TM:REGION 148->170| SEG 11->21|fllfsllfslf| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------11------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,73-73,76-76,81-81,87-87,129-130,132-132,137-137,157-157| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccc //