[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63237.1
DDBJ      :             translation initiation factor aIF-1A
Swiss-Prot:IF1A_PYRAE   RecName: Full=Translation initiation factor 1A;         Short=aIF-1A;

Homologs  Archaea  20/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:97 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->90 1jt8A PDBj 3e-10 36.6 %
:RPS:PDB   3->85 2dgyA PDBj 1e-09 22.9 %
:RPS:SCOP  7->90 1jt8A  b.40.4.5 * 7e-14 35.7 %
:HMM:SCOP  1->87 1d7qA_ b.40.4.5 * 5.7e-28 36.8 %
:HMM:PFM   9->72 PF01176 * eIF-1a 1.2e-28 43.8 64/65  
:BLT:SWISS 1->97 IF1A_PYRAE 1e-42 100.0 %
:PROS 19->41|PS01262|IF1A
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63237.1 GT:GENE AAL63237.1 GT:PRODUCT translation initiation factor aIF-1A GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(627997..628290) GB:FROM 627997 GB:TO 628290 GB:DIRECTION - GB:PRODUCT translation initiation factor aIF-1A GB:NOTE Protein synthesis; Translation factors GB:PROTEIN_ID AAL63237.1 GB:DB_XREF GI:18159841 LENGTH 97 SQ:AASEQ MSEFRLPGEGEILGKVIEMLGDGRFKVICADGQIRVARLPGRLRRRLWLKAGDYVIVALWDFDREKGDIVHKYEKRDVEELKRRGFAEAIEALDSYA GT:EXON 1|1-97:0| SW:ID IF1A_PYRAE SW:DE RecName: Full=Translation initiation factor 1A; Short=aIF-1A; SW:GN Name=eIF1A; OrderedLocusNames=PAE1072; SW:KW Complete proteome; Initiation factor; Protein biosynthesis. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->97|IF1A_PYRAE|1e-42|100.0|97/114| GO:SWS:NREP 2 GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 19->41|PS01262|IF1A|PDOC00970| SEG 35->49|rvarlpgrlrrrlwl| BL:PDB:NREP 1 BL:PDB:REP 9->90|1jt8A|3e-10|36.6|82/102| RP:PDB:NREP 1 RP:PDB:REP 3->85|2dgyA|1e-09|22.9|83/111| HM:PFM:NREP 1 HM:PFM:REP 9->72|PF01176|1.2e-28|43.8|64/65|eIF-1a| RP:SCP:NREP 1 RP:SCP:REP 7->90|1jt8A|7e-14|35.7|84/102|b.40.4.5| HM:SCP:REP 1->87|1d7qA_|5.7e-28|36.8|87/143|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 22 OP:NHOMOORG 20 OP:PATTERN ----1------------1111111111-1-1-111------------------1----------11-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 90.7 SQ:SECSTR ##cccccccccEEEEEEEcccccEEEEEcTTccEEEEEccTTcccccccccccEEEEEEcccccccEEEEEEccHHHHHHHHHHTHHHHc####### DISOP:02AL 95-97| PSIPRED ccccccccccEEEEEEEEEccccEEEEEEccccEEEEEEccccccEEEEccccEEEEEEccccccEEEEEEEEccHHHHHHHHcccccccccccccc //