[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63243.1
DDBJ      :             P. aerophilum family 79 protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:186 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 114->184 ATP6_BACSU 7e-04 30.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63243.1 GT:GENE AAL63243.1 GT:PRODUCT P. aerophilum family 79 protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 633095..633655 GB:FROM 633095 GB:TO 633655 GB:DIRECTION + GB:PRODUCT P. aerophilum family 79 protein GB:NOTE Hypothetical; Conserved within genome GB:PROTEIN_ID AAL63243.1 GB:DB_XREF GI:18159847 LENGTH 186 SQ:AASEQ MRLVRELGLKYLAFSPAILAFPYLSYGPLVSWDPSWGFRMGVGLMGLGHYLYLVMQVAYYACKLPPKYIALSTAAFLAYFLSLTRPELVVLSLVGLIYSAAVVLYFGVKDGVFANWLGAIAWLFLWNLIGGVLSIPAHIYFGGGDIWLWWREPPADPLYALAVGIAGAVATWALGKIRLLVEFTCR GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 114->184|ATP6_BACSU|7e-04|30.9|68/100| TM:NTM 5 TM:REGION 2->24| TM:REGION 39->61| TM:REGION 78->100| TM:REGION 116->138| TM:REGION 157->176| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHccHHHHHccHHHHHcccccccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHEEEEEEEcc //