[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63245.1
DDBJ      :             P. aerophilum family 70 protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63245.1 GT:GENE AAL63245.1 GT:PRODUCT P. aerophilum family 70 protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 636089..636517 GB:FROM 636089 GB:TO 636517 GB:DIRECTION + GB:PRODUCT P. aerophilum family 70 protein GB:NOTE Hypothetical; Conserved within genome GB:PROTEIN_ID AAL63245.1 GB:DB_XREF GI:18159849 LENGTH 142 SQ:AASEQ MAYTFSVVSAVCLFVSCRRYFYTAAAFGAVLWGLSFAYPHFLVAFLSMWLYLGWAWLGLLWASWRLWRVKGVVTAFAALYVINLMYIPLEFANLLPDWALAAIGDNPRTTFLNWARYLLTYLTTMAVLQTIRVLAKLDQRRR GT:EXON 1|1-142:0| TM:NTM 3 TM:REGION 23->45| TM:REGION 77->99| TM:REGION 109->131| SEG 49->68|wlylgwawlgllwaswrlwr| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN ------------------2------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 139-142| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //