[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63249.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.159.1
:210 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   55->207 2yvtA PDBj 7e-08 32.9 %
:RPS:PDB   1->193 2dxnA PDBj 2e-09 18.7 %
:RPS:SCOP  53->208 2yvtA1  d.159.1.6 * 2e-39 31.6 %
:HMM:SCOP  1->207 1uf3A_ d.159.1.6 * 3.6e-39 41.0 %
:HMM:PFM   1->169 PF00149 * Metallophos 6.4e-11 20.8 168/200  
:BLT:SWISS 1->185 Y1162_METJA 4e-13 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63249.1 GT:GENE AAL63249.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(638625..639257) GB:FROM 638625 GB:TO 639257 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63249.1 GB:DB_XREF GI:18159854 LENGTH 210 SQ:AASEQ MRLLLVADVHDGVKQVRLIRGSYDAVIAAGDFTYKRSVEAAVEALEALAGIAPVYFVPGNTDPPELAGFEKDSIKPVHGRTQRLGPYVIGGAGGSLPTPFNDLFRVSEEDLQGLLYSLTPTPHVLVVHNPPRGHLDKVGGVRPVGSLAVKKYIEEKQPILSVHGHIHEDRGIDIIGDTIVVNPGPLKDGYYAEAVLDGTKAVVSLKKLYY GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 1->185|Y1162_METJA|4e-13|31.0|184/218| SEG 38->49|veaavealeala| BL:PDB:NREP 1 BL:PDB:REP 55->207|2yvtA|7e-08|32.9|149/256| RP:PDB:NREP 1 RP:PDB:REP 1->193|2dxnA|2e-09|18.7|193/271| HM:PFM:NREP 1 HM:PFM:REP 1->169|PF00149|6.4e-11|20.8|168/200|Metallophos| RP:SCP:NREP 1 RP:SCP:REP 53->208|2yvtA1|2e-39|31.6|152/257|d.159.1.6| HM:SCP:REP 1->207|1uf3A_|3.6e-39|41.0|200/0|d.159.1.6|1/1|Metallo-dependent phosphatases| OP:NHOMO 96 OP:NHOMOORG 79 OP:PATTERN 1112123-22222223-1111111--------11111111111111111111111111111---2--- --1-------------------------------------------------------------------------------1-------------------------1------------------------------11----2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------112-111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111--------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 100.0 SQ:SECSTR cEEEEEccccccHHHHTTccccccEEEEcccccccccHHHHHHHHHHHHTcccEEEcccTTcHGGGcGGGcccTTcccEEEcccccEEEEcccccTTcccccccHHHHHHHHHHHHTTTTccEEEEEcccccccTTTcTTccTTTHHHHHHHHHcTTEEEEEEcccccccEEEETTEEEEEccccccccccccEEEETTTTEEEEEEccc PSIPRED cEEEEEccccccHHHHHHccccccEEEEEccccccccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHccEEccccEEEEccEEEEEccccccccccccccccHHHHHHHHHHccccccEEEEEcccccccccccccccccHHHHHHHHHHHcccEEEEccccccccEEEEccEEEEEcccccccccEEEEEEccEEEEEEEEEcc //