[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63280.1
DDBJ      :             tRNA pseudouridine synthase A
Swiss-Prot:TRUA_PYRAE   RecName: Full=tRNA pseudouridine synthase A;         EC=5.4.99.12;AltName: Full=tRNA-uridine isomerase I;AltName: Full=tRNA pseudouridylate synthase I;

Homologs  Archaea  39/68 : Bacteria  527/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
d.265.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->176 1dj0A PDBj 1e-11 34.1 %
:RPS:PDB   1->217 1dj0A PDBj 1e-43 30.7 %
:RPS:SCOP  1->217 1dj0A  d.265.1.1 * 5e-44 30.7 %
:HMM:SCOP  1->230 1dj0A_ d.265.1.1 * 3.8e-41 36.2 %
:RPS:PFM   7->68 PF01416 * PseudoU_synth_1 2e-04 51.6 %
:HMM:PFM   7->88 PF01416 * PseudoU_synth_1 6.5e-05 37.0 73/105  
:HMM:PFM   111->213 PF01416 * PseudoU_synth_1 3.5e-18 31.7 101/105  
:BLT:SWISS 1->256 TRUA_PYRAE e-140 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63280.1 GT:GENE AAL63280.1 GT:PRODUCT tRNA pseudouridine synthase A GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(671709..672479) GB:FROM 671709 GB:TO 672479 GB:DIRECTION - GB:PRODUCT tRNA pseudouridine synthase A GB:NOTE Protein synthesis; tRNA and rRNA base modification GB:PROTEIN_ID AAL63280.1 GB:DB_XREF GI:18159888 LENGTH 256 SQ:AASEQ MPYLYRIAYDGTMFYGFTGHPNSLEPRLRLIFGEILGRGSRTDPGVSAVGNVVMTGRKMALGYVNSKMPKGAWAWGIAEVPEGFNPRRAKLRRYLYVAPHWGEDVDVMREAAKLLTGTHDYSSFIQLRGEKHTPTVTTVYDIDVTLRGDLIFIYFAGRGFRNKMIRKMAWALLAAGRGVLSVDDLADLLKKPRPGAVPSAPAEGLVLLDIVYDVKFEVDFSALRKAYVYFLSKSRHLSAHAAALRAAGEALAMWES GT:EXON 1|1-256:0| SW:ID TRUA_PYRAE SW:DE RecName: Full=tRNA pseudouridine synthase A; EC=5.4.99.12;AltName: Full=tRNA-uridine isomerase I;AltName: Full=tRNA pseudouridylate synthase I; SW:GN Name=truA; OrderedLocusNames=PAE1142; SW:KW Complete proteome; Isomerase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->256|TRUA_PYRAE|e-140|100.0|256/256| GO:SWS:NREP 2 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 234->247|srhlsahaaalraa| BL:PDB:NREP 1 BL:PDB:REP 2->176|1dj0A|1e-11|34.1|173/264| RP:PDB:NREP 1 RP:PDB:REP 1->217|1dj0A|1e-43|30.7|215/264| RP:PFM:NREP 1 RP:PFM:REP 7->68|PF01416|2e-04|51.6|62/112|PseudoU_synth_1| HM:PFM:NREP 2 HM:PFM:REP 7->88|PF01416|6.5e-05|37.0|73/105|PseudoU_synth_1| HM:PFM:REP 111->213|PF01416|3.5e-18|31.7|101/105|PseudoU_synth_1| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF01416|IPR020097| GO:PFM GO:0003723|"GO:RNA binding"|PF01416|IPR020097| GO:PFM GO:0009451|"GO:RNA modification"|PF01416|IPR020097| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF01416|IPR020097| RP:SCP:NREP 1 RP:SCP:REP 1->217|1dj0A|5e-44|30.7|215/264|d.265.1.1| HM:SCP:REP 1->230|1dj0A_|3.8e-41|36.2|229/264|d.265.1.1|1/1|Pseudouridine synthase| OP:NHOMO 620 OP:NHOMOORG 582 OP:PATTERN ------------------111111---1111--1111111111111111111111111111-1----- 1---1--1---1--11---------1----------1111-11-------------------1----1----------11-1-1--11-----1---------1-------1111111-1111121----------1111------------111------------------11--1--1--------1--11-22222222222222111111222111-11111111111111111111111111---1--111111111111111111111111-1111111-11111111111111111111111111-111111111122111111111-1-121122221211--22--11111121--1111----111111-111111---111-----11111111111--11---11-11-111111111111-11------------11111111---1-1-1------------1---11111-11-----------111111111111111111111111-111-111111111---------1-11--1-1--111111111111--11-111--11----111111111---11-1----------------------1--111111111111--1111111-1111--111111--11-----1111----111111111111-1111111111111111111111--1-11-11111111111111-11111111-1-----------1--------11111-111111111111-111-11111111--11-111111111-1111111-1111111111--11111111111-----------------1--11------------1-----------1-------------11111111111-1 --------------------------------------------------------------1------------------------------------------11----111-1-------------------------------------------------------1-------7212-1-----11----1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 84.8 SQ:SECSTR EEEEEEEEEccTTccccccTTcHHHHHHHHHHTccEEEcccccTTcEEEEEEEccHHHHHHHEHHHTccTTEEEEEEEEccTTccTTTccEEEEEEEEEcccccHHHHHHHHGGGcEEEEcGGGccTTccccccEEEEEEEEEEEEETTEEEEEEEEccccTTHHHHHHHHHHHHHTTcccTTHHHHHHHccGGGcccccccTTEEEEEEEccGGGc####################################### DISOP:02AL 256-257| PSIPRED cEEEEEEEEcccccEEEEEccccHHHHHHHHHHHHHHccccccccHHHcccEEEEccHHHHHHHHHHccccEEEEEEEEccccccccccccEEEEEEEccccccHHHHHHHHHHHccccccHHHHHcccccccccEEEEEEEEEEEEccEEEEEEEEcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHcccccccHHHHccccccccccc //