[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63285.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63285.1 GT:GENE AAL63285.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 676103..676624 GB:FROM 676103 GB:TO 676624 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63285.1 GB:DB_XREF GI:18159893 LENGTH 173 SQ:AASEQ MEEEIIPVYAQGFYVVSQGVVNMIIIFDYLDKGQYYYKLLKRGGEGLSREIATVWENMQRFMDEEIVRVNGERVRPVLHEVYIALRGSPTRPYITFIGSFPAPLRPGENLYENYYEEEVAEYDYEAVWIFPKGAEVLEWHFGGEVETPEPNILRVVVAKGTNVGGREYIKFRM GT:EXON 1|1-173:0| SEG 108->127|enlyenyyeeevaeydyeav| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN --1-11-1-------11111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccEEEEEEEEEEEccccEEEEEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEccEEEEEEEEEEEEEEEccccccEEEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEEEEEEEccccEEEEEEcccccccccEEEEEEc //