[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63296.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  92/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:183 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   43->134 1ve3B PDBj 2e-07 34.8 %
:RPS:PDB   32->144 3bkwA PDBj 5e-15 22.1 %
:RPS:SCOP  1->143 2avnA1  c.66.1.41 * 2e-21 24.5 %
:HMM:SCOP  1->181 1xvaA_ c.66.1.5 * 3.2e-31 34.1 %
:RPS:PFM   32->70 PF07021 * MetW 1e-04 46.2 %
:RPS:PFM   45->134 PF08241 * Methyltransf_11 2e-13 40.0 %
:HMM:PFM   45->134 PF08241 * Methyltransf_11 1.7e-21 36.7 90/95  
:BLT:SWISS 21->137 UBIE_THET2 1e-12 34.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63296.1 GT:GENE AAL63296.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 682909..683460 GB:FROM 682909 GB:TO 683460 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63296.1 GB:DB_XREF GI:18159905 LENGTH 183 SQ:AASEQ MEIEIFSSRSAWFYNILVSLKLFQWAYGLAYRRISKLAPPGSRVLEIGPGVGELLKILDKGGYAAVGLDISPPMLKYAQRRAPGVSVAGASFKAPLRDGAFDAAVALFTLHHWGDHEPSVHEIWRLLKPGGYFIAVEVDLHRMPLVGSHGCTEECMKRVLGMKFAVTIERPFPLLVAVARKTQ GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 21->137|UBIE_THET2|1e-12|34.2|117/220| BL:PDB:NREP 1 BL:PDB:REP 43->134|1ve3B|2e-07|34.8|92/222| RP:PDB:NREP 1 RP:PDB:REP 32->144|3bkwA|5e-15|22.1|113/215| RP:PFM:NREP 2 RP:PFM:REP 32->70|PF07021|1e-04|46.2|39/189|MetW| RP:PFM:REP 45->134|PF08241|2e-13|40.0|90/96|Methyltransf_11| HM:PFM:NREP 1 HM:PFM:REP 45->134|PF08241|1.7e-21|36.7|90/95|Methyltransf_11| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 1->143|2avnA1|2e-21|24.5|143/246|c.66.1.41| HM:SCP:REP 1->181|1xvaA_|3.2e-31|34.1|179/292|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 121 OP:NHOMOORG 104 OP:PATTERN -----------------111111--------------------1--11-------------------- --112-------1--11----1--12-----1-1112211-2-111--1----12--1--12--11-1-11--------------1------------------------------------------11111111-1123----31--2-------1-1--11---11---------1-----1-11----------------------------------------------------------------------------1------------------------------------------------------------------------------------------1---1----------------------------------------------------------1-1---------------------------1---------11----------------------------------------------------1111----111111--1------11-----------------------------------------1-1-111-1-1-1---------1-3---------------------------------------------------------------------------------------------------------------------------11------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------1---2------------------------------------------------------------------------1----------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 99.5 SQ:SECSTR HEEHHcccHHcccGGGccccTTTcccHHHHHHHHHHHccTTcEEEEETcTTcHHHHHHHHTTccEEEEEEccHHHHHHHHTcccEEEEccGGGccccTTcEEEEEEEccGGGcccHHHHHHHHHHHEEEEEEEEEEEEcHHHHcHHTTcHHHHHHHEEcEEEccTTccTTEEEcccHHHHTc# PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHcccEEEEEEccHHHHHHHHHHcccccEEEcHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHccc //