[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63319.1
DDBJ      :             ABC transporter ATP-binding protein, putative
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  900/915 : Eukaryota  152/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:228 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->218 2yyzA PDBj 8e-18 30.9 %
:RPS:PDB   1->200 2dwoA PDBj 8e-28 9.2 %
:RPS:SCOP  3->207 1sgwA  c.37.1.12 * 2e-27 23.8 %
:HMM:SCOP  12->207 1ii8.1 c.37.1.12 * 9.9e-40 35.4 %
:RPS:PFM   36->86 PF00437 * GSPII_E 2e-04 34.0 %
:HMM:PFM   49->160 PF00005 * ABC_tran 2.2e-10 26.9 104/118  
:HMM:PFM   34->60 PF02367 * UPF0079 0.00042 37.0 27/123  
:BLT:SWISS 15->225 NODI_RHIS3 1e-22 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63319.1 GT:GENE AAL63319.1 GT:PRODUCT ABC transporter ATP-binding protein, putative GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(702708..703394) GB:FROM 702708 GB:TO 703394 GB:DIRECTION - GB:PRODUCT ABC transporter ATP-binding protein, putative GB:NOTE Transport and binding proteins; Unknown substrate GB:PROTEIN_ID AAL63319.1 GB:DB_XREF GI:18159929 LENGTH 228 SQ:AASEQ MVIVRFEEVSKYYRKSRFGNEFVVALDNVSFEIDGGIVGLNGPNGAGKTTAIRLMLRLIEPTKGRVVTNFSPYDVGYIPQEAHPDEFLTLYENMVLILRLHGLSKDKSRTVARELVTKFDLMSHADKPAFKLSEGLKRKSIVLPILFGLEKRCYVLDEPFEYLDYETRMAVISRLRELKVSGAAVVLSTHNLYEAKNILDKAIILKNKLVKIVEENEISRLEEFLIAS GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 15->225|NODI_RHIS3|1e-22|33.3|207/304| BL:PDB:NREP 1 BL:PDB:REP 4->218|2yyzA|8e-18|30.9|207/358| RP:PDB:NREP 1 RP:PDB:REP 1->200|2dwoA|8e-28|9.2|185/449| RP:PFM:NREP 1 RP:PFM:REP 36->86|PF00437|2e-04|34.0|47/273|GSPII_E| HM:PFM:NREP 2 HM:PFM:REP 49->160|PF00005|2.2e-10|26.9|104/118|ABC_tran| HM:PFM:REP 34->60|PF02367|0.00042|37.0|27/123|UPF0079| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00437|IPR001482| GO:PFM GO:0005622|"GO:intracellular"|PF00437|IPR001482| GO:PFM GO:0006810|"GO:transport"|PF00437|IPR001482| RP:SCP:NREP 1 RP:SCP:REP 3->207|1sgwA|2e-27|23.8|189/200|c.37.1.12| HM:SCP:REP 12->207|1ii8.1|9.9e-40|35.4|192/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 15219 OP:NHOMOORG 1120 OP:PATTERN LLG6JCBFGGHEGDIGWADBAHCOU9BJFJHE8677A7A8875EQ9GJBHcRI6GSIOMDGACAL133 ADS9l7AFBBD9E6CDAAA-AH22ETA9AAA9JIHJLahdAIAHBTEDEDC6LIK96B44KMEFOMMVYbEA888LBBB6LCN53247BB97-6464--47C6A8CBG89332222333444447AA536225494HLLML997OHBFGJEDGJIAB557464EDBGJIG9664443564454EAD98LG4BJPddeddYalXieaYbfcORRNShigIIKSXJQSUVSQUfmFFFFFFFFFFFFFEEDHFBDKHCDMJB9HCJJJ89TRHGDCKEEIIMLNIIJNMRQGHHGFIGGHGGIIGGHIIKHGHIHUIJFEGKKKLNUJZYYYYbaeWKYIOSSSKJIGgKJFGSGIC7feGFCJMHBJRHPNAA9BDHA88856556CAmcj86JPLGNKNOKMNKQJNMh-EDJECSFGQb74*eeVdcRuotheeQ679MGgOINONCL87888888G4548AAI111-3111--3233334333332232121864557FPKDIKJLILIDFEECKKVZGFFFBHLKcIINJ38EFCC7D9AMBMJWN8A86B68B878666668B7AEBCGQ7A8DG79JDCF6GCE5C9GAGBDCBLEHH579A65666632311111117436386AAI7B8C776GCBABA88BAAABCAEADCE1-26855-1-111QINMAKGIIIJIKIKGG-GHIGKIJHHFHKJGHHHHHQUQRSGDEEFCEEFEGEFGFEFEEJDFEGHHH82HKLMLLLKJLLM22869B9AB9799A6FEHDCDEC97797689AD99AA95A469GAGEEEFKLMFGIEGCOOL8654556567EFDFHJIIJFHFGHBAA99999996777238C77455623222322K6944233-345144-111-35123222HQREFLWMKM6C8 --11C93-HA237C5222111111-1-11----12111-1--111121221232113-12111-1----2-------------1-3----21212-----------1321B9B9H9C76729A9RQ5K4W*F3H7K9B85G86G96B666I54p6DC8H59U78632B9CR46A62362L22214878A2B532E7AB6 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 227-228| PSIPRED ccEEEEEccEEEEcccccccccEEEEccccEEEccEEEEEEccccccHHHHHHHHHccccccccEEEEEcEEEEEEEEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccccHHHHHHHHHcc //