[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63337.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->120 1xxlA PDBj 2e-08 33.0 %
:RPS:PDB   15->112 3eeyI PDBj 1e-11 16.3 %
:RPS:SCOP  15->155 1f38A  c.66.1.22 * 1e-13 20.8 %
:HMM:SCOP  2->140 1r74A_ c.66.1.5 * 1.4e-23 31.9 %
:RPS:PFM   7->46 PF00398 * RrnaAD 7e-05 45.0 %
:RPS:PFM   19->109 PF08241 * Methyltransf_11 3e-12 43.2 %
:HMM:PFM   19->109 PF08241 * Methyltransf_11 5e-20 37.9 87/95  
:BLT:SWISS 3->120 YCGJ_BACSU 7e-08 35.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63337.1 GT:GENE AAL63337.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 720607..721098 GB:FROM 720607 GB:TO 721098 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63337.1 GB:DB_XREF GI:18159949 LENGTH 163 SQ:AASEQ MWSEIFKDLDAFELGESALDVGAGFGNTTRYLLARGLRVCAVDIDPGAVAYIKSLFKEFVKSGLLKVLLAPAESLPFADGECDSVISVAAVHHFRDIEVALREMVRVAKRLVAIYDWTPEAGGVTNPHSPQELEAKMRAAADAAVKLGFDIKITRYWYRLVKF GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 3->120|YCGJ_BACSU|7e-08|35.7|115/253| SEG 139->144|aaadaa| BL:PDB:NREP 1 BL:PDB:REP 19->120|1xxlA|2e-08|33.0|100/231| RP:PDB:NREP 1 RP:PDB:REP 15->112|3eeyI|1e-11|16.3|98/186| RP:PFM:NREP 2 RP:PFM:REP 7->46|PF00398|7e-05|45.0|40/256|RrnaAD| RP:PFM:REP 19->109|PF08241|3e-12|43.2|88/96|Methyltransf_11| HM:PFM:NREP 1 HM:PFM:REP 19->109|PF08241|5e-20|37.9|87/95|Methyltransf_11| GO:PFM:NREP 5 GO:PFM GO:0000154|"GO:rRNA modification"|PF00398|IPR001737| GO:PFM GO:0000179|"GO:rRNA (adenine-N6,N6-)-dimethyltransferase activity"|PF00398|IPR001737| GO:PFM GO:0008649|"GO:rRNA methyltransferase activity"|PF00398|IPR001737| GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 15->155|1f38A|1e-13|20.8|125/186|c.66.1.22| HM:SCP:REP 2->140|1r74A_|1.4e-23|31.9|138/0|c.66.1.5|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN ------------------11211--------------------------------------1------ ----1----------------------------111--------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHccTTTcEEEEcccTTcHHHHHHHHHHcTTcEEcccHHHHHHHHHHHHHTTcGGGEEEEcccGGGGGTccccEEEEEEEEcccTTccHHHHHHHHHHHHHHEEEEEEccHHHcccccTTcGHHHHHHHHHTTcTTccEEEEEEEEEEcGGGccc DISOP:02AL 162-164| PSIPRED ccHHHHHHHHccccccEEEEEcccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccccEEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccEEcccHHHHEEEcc //