[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63345.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:48 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->33 PF00280 * potato_inhibit 0.00027 26.9 26/63  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63345.1 GT:GENE AAL63345.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 725011..725157 GB:FROM 725011 GB:TO 725157 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63345.1 GB:DB_XREF GI:18159957 LENGTH 48 SQ:AASEQ MNFLCKKGAAIPVAKAVIERDKSLASIKASREGLLKVEIKYEPPQGNC GT:EXON 1|1-48:0| HM:PFM:NREP 1 HM:PFM:REP 8->33|PF00280|0.00027|26.9|26/63|potato_inhibit| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 4-7, 45-48| PSIPRED cccccccccccHHHHHHHHccccHHHHHcccccEEEEEEEEccccccc //