[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63358.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:369 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 155->220 Y1253_HAEIN 6e-04 31.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63358.1 GT:GENE AAL63358.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 734876..735985 GB:FROM 734876 GB:TO 735985 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63358.1 GB:DB_XREF GI:18159971 LENGTH 369 SQ:AASEQ MTYPIGYLYPNEFAQPLQWLPVLFSYSLLISGADLLLVAAIAYLFNKLRKTTPLLLIVGLAFYTVVLLGPLADLRNPDRAPLLFTYPQLIPTAVHPGVSLIALQGALMWPLGFIIAALFTLLYFAPANYQRYLATRNPFYKALSLGIKEHGPGLRTLLKILAVVMLIPMAFWAIYPASLLSTQTSLFIWKNWHTLIPVHFADTFVVATAAIILAIWIYGVRKIGQNELNSILTIHGVAAISVVALLLLQIALWNSIYGGSQYMAVISQISSWMMPVIALYIITFIVSIIATKYTPLSLVVPFTGIAVAVINKWNILVRAQYAQKSGLAYLGPEEEILAHEVPIMISIIAAGVFLAIVLSVLFPVGRNYD GT:EXON 1|1-369:0| BL:SWS:NREP 1 BL:SWS:REP 155->220|Y1253_HAEIN|6e-04|31.8|66/100| TM:NTM 9 TM:REGION 20->42| TM:REGION 52->74| TM:REGION 100->122| TM:REGION 155->177| TM:REGION 199->220| TM:REGION 231->253| TM:REGION 267->289| TM:REGION 294->316| TM:REGION 341->363| SEG 237->252|vaaisvvallllqial| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN 11----------------111--1-------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 368-369| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHccEEEEEEHHHHcccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //