[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63363.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.38.1
:329 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  129->217 2oauA1  b.38.1.3 * 2e-10 27.7 %
:HMM:SCOP  127->217 2oauA1 b.38.1.3 * 1.8e-11 44.8 %
:RPS:PFM   85->252 PF00924 * MS_channel 2e-08 30.2 %
:HMM:PFM   85->256 PF00924 * MS_channel 9.9e-23 32.0 147/207  
:BLT:SWISS 50->256 Y437_BUCAP 4e-06 37.1 %
:BLT:SWISS 238->327 CC141_HUMAN 4e-04 25.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63363.1 GT:GENE AAL63363.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(742897..743886) GB:FROM 742897 GB:TO 743886 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63363.1 GB:DB_XREF GI:18159977 LENGTH 329 SQ:AASEQ MTSARRLWLLAISKVAVAVVASYATYQLVKFLDFHLRLGITPDIYGALIALITVVTGVVVSNIIGNTIIIHLKPTLKERAFSVGNVVKILGFLFSVIIAFTIGRVGAEAAVLGGTVTGLILGLALQPVLGNLFAGLVVLTTRFVTVGDVVRIASTGLPYQWAFLPAYKYFSPDYIVPGYKGRVVEIGLFYTTLILDTGQELRIPNSILLNSGVVDYTPKWSERKIINVRVELPLSIIDFDRLEEEIKEVLSEFNVIAVDYTEQSDKDHVIIRIKIEVPEDADWRDIKSKALKSVLKYRESKILDKFYKYACLTRGVLCDAFNKQLQRSD GT:EXON 1|1-329:0| BL:SWS:NREP 2 BL:SWS:REP 50->256|Y437_BUCAP|4e-06|37.1|170/283| BL:SWS:REP 238->327|CC141_HUMAN|4e-04|25.0|88/875| TM:NTM 5 TM:REGION 7->29| TM:REGION 49->71| TM:REGION 81->103| TM:REGION 108->130| TM:REGION 135->157| SEG 15->21|vavavva| SEG 110->125|avlggtvtglilglal| RP:PFM:NREP 1 RP:PFM:REP 85->252|PF00924|2e-08|30.2|139/203|MS_channel| HM:PFM:NREP 1 HM:PFM:REP 85->256|PF00924|9.9e-23|32.0|147/207|MS_channel| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00924|IPR006685| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00924|IPR006685| RP:SCP:NREP 1 RP:SCP:REP 129->217|2oauA1|2e-10|27.7|65/67|b.38.1.3| HM:SCP:REP 127->217|2oauA1|1.8e-11|44.8|67/0|b.38.1.3|1/1|Sm-like ribonucleoproteins| OP:NHOMO 25 OP:NHOMOORG 18 OP:PATTERN ------1122222221--11111--------------------------------------111---- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 327-329| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccccccccccEEEEEEEEEEEEEEEEcccccEEEEccHHHHccEEEEEEccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHcccHHHcHHHHccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccEEEEEccccccccc //