[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63374.1
DDBJ      :             glycolate oxidase subunit glcE
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  467/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.58.32
:327 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->193 2uuvC PDBj 3e-18 33.3 %
:RPS:PDB   2->293 1ahuA PDBj 1e-26 12.7 %
:RPS:SCOP  2->179 1mbbA1  d.145.1.2 * 1e-24 10.0 %
:RPS:SCOP  158->326 1f0xA1  d.58.32.2 * 2e-07 14.4 %
:HMM:SCOP  2->172 1e8gA2 d.145.1.1 * 7.2e-31 29.6 %
:HMM:SCOP  303->327 1e8gA1 d.58.32.1 * 7.1e-05 44.0 %
:RPS:PFM   1->135 PF01565 * FAD_binding_4 1e-10 28.1 %
:HMM:PFM   2->134 PF01565 * FAD_binding_4 4.2e-25 30.3 132/138  
:HMM:PFM   298->325 PF02913 * FAD-oxidase_C 1.1e-07 42.9 28/249  
:BLT:SWISS 7->248 GLCE_ECOLI 4e-21 30.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63374.1 GT:GENE AAL63374.1 GT:PRODUCT glycolate oxidase subunit glcE GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(755833..756816) GB:FROM 755833 GB:TO 756816 GB:DIRECTION - GB:PRODUCT glycolate oxidase subunit glcE GB:NOTE Central intermediary metabolism; Other GB:PROTEIN_ID AAL63374.1 GB:DB_XREF GI:18159989 LENGTH 327 SQ:AASEQ MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEMVVRTSACISAVELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLLSVKIVTGKGEFMKFGAPVVKDVAGYNIKRLIAGSWGTLAVLVEAYMRIYALPESVAVMATGRKSLQELRKLHVAGAAEADGVLYLRFEGVKSEVEYRLSKAGRGDVFYDREAEEKWSSVTEAEELFASNEIAKVVAPPASLPETPPGVKYLRYPLLGVMYVAGPPPAGVKAYWLKPQRKWDVENRDLMEKIKRVLDPNGVLSPGRLP GT:EXON 1|1-327:0| BL:SWS:NREP 1 BL:SWS:REP 7->248|GLCE_ECOLI|4e-21|30.7|231/350| BL:PDB:NREP 1 BL:PDB:REP 3->193|2uuvC|3e-18|33.3|183/491| RP:PDB:NREP 1 RP:PDB:REP 2->293|1ahuA|1e-26|12.7|291/555| RP:PFM:NREP 1 RP:PFM:REP 1->135|PF01565|1e-10|28.1|135/139|FAD_binding_4| HM:PFM:NREP 2 HM:PFM:REP 2->134|PF01565|4.2e-25|30.3|132/138|FAD_binding_4| HM:PFM:REP 298->325|PF02913|1.1e-07|42.9|28/249|FAD-oxidase_C| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| RP:SCP:NREP 2 RP:SCP:REP 2->179|1mbbA1|1e-24|10.0|170/198|d.145.1.2| RP:SCP:REP 158->326|1f0xA1|2e-07|14.4|167/237|d.58.32.2| HM:SCP:REP 2->172|1e8gA2|7.2e-31|29.6|169/0|d.145.1.1|1/1|FAD-binding domain| HM:SCP:REP 303->327|1e8gA1|7.1e-05|44.0|25/0|d.58.32.1|1/1|FAD-linked oxidases, C-terminal domain| OP:NHOMO 1304 OP:NHOMOORG 657 OP:PATTERN 11---1221222221211232213-------1----------------12111-------12113--- --112-------1-21122-21113133333111111662-3211----1111211----111-133211---------1-1111111--------------1---------------------------------66633----22111111211111-11111111122-1-----1----11111---21122222222222222242111122223313--------2------------------------111-----11--11------------------------------------------------------3-11-----1-2-2-122111121-1-1--2-341111--32--1--1-2211--2111-1127443344444533333332334-22321323344-23333363335643---34222222232222222221122122-----------------------------2124-1222235334353333344563333224442443--22233433436434112211--211-1111222223-2511214221333-212112212222223131--111111111111111111111122----2------------------------1---3112-------------1---1-1111--111111111-1111111--1-----------------------------------------------1--111----21212---------------11111111322-22222322322232223------------------------112112111111111-1-111111----------1--------------------------11---1---3-1 ----332-32--2321332243343522222122222222-2212222333242212324441221332311113211222332231--1223131--1-1--221-121521142-1---22-42121383-2121--12--2111---2--21-1-33533231232331232211--1-1--3--421-1132322 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 326 STR:RPRED 99.7 SQ:SECSTR EccccHHHHHHHHHHHHHHTccEEEEcccccTTTTTTccccTTcEEEEcccEEEEETTTTEEEEcTTccHHHHHHHHHTTTGGGTEEccccccccccHHHHHHHTcccccTTccTGGGEEEEEEEcTTccEEEcGGccTTTcccccGGGGGGGccccccEEEEEEEEcEEccccEEEEEEEEccTTHHHHHHHHHHHHHHHTccccccEEEEEHHHHHHHHcccTTTccccccccHHHHHHHHHHHTcccEEEEEEEEccHHHHHHHHHHHHHHGcTTcEEEcGGGcccccHHEccccccHHHHHHHHHHHHHcTTEEEEEEETGG# DISOP:02AL 327-328| PSIPRED cccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccEEEEEccccccEEEEEccccEEEEEccccHHHHHHHHHHcccEEccccccccccccccccccccccccccccccHHHHEEEEEEEcccccEEEEccccccccccccHHHHHHcccccEEEEEEEEEEEEEccccEEEEEEEcccHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccEEEEccccHHHcccccEEEEccccEEEEEccccccccEEEEEcccccccHHHHHHHHHHHHHHcccccccccccc //