[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63400.1
DDBJ      :             conserved hypothetical protein, authentic frameshift
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.24.16
:111 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->73 1o3uA  a.24.16.3 * 2e-10 22.5 %
:HMM:SCOP  2->72 1o3uA_ a.24.16.3 * 9.1e-07 30.0 %
:HMM:PFM   3->65 PF05168 * HEPN 8.4e-13 34.9 63/117  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63400.1 GT:GENE AAL63400.1 GT:PRODUCT conserved hypothetical protein, authentic frameshift GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 782022..782357 GB:FROM 782022 GB:TO 782357 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein, authentic frameshift GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63400.1 GB:DB_XREF GI:18160017 LENGTH 111 SQ:AASEQ MHFLRERALQFYEQATFTLERGYCEMLFNIEQALQLYMKYLLYRKIGDYPKSHFLRDIADRLVEIYETIAALKITSKGGDRSWRCWNRPTSPLGICPLKPGGRTAKRRIRC GT:EXON 1|1-111:0| HM:PFM:NREP 1 HM:PFM:REP 3->65|PF05168|8.4e-13|34.9|63/117|HEPN| RP:SCP:NREP 1 RP:SCP:REP 2->73|1o3uA|2e-10|22.5|71/120|a.24.16.3| HM:SCP:REP 2->72|1o3uA_|9.1e-07|30.0|70/126|a.24.16.3|1/1|Nucleotidyltransferase substrate binding subunit/domain| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------1-----------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 105-106| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccc //