[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63413.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.2.10
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->126 2k6wA PDBj 1e-06 35.8 %
:RPS:SCOP  27->133 1x9lA  b.2.10.1 * 2e-10 27.6 %
:HMM:SCOP  3->138 1x9lA_ b.2.10.1 * 2e-19 25.4 %
:RPS:PFM   68->110 PF04314 * DUF461 2e-07 41.9 %
:HMM:PFM   27->127 PF04314 * DUF461 2.6e-17 27.3 99/110  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63413.1 GT:GENE AAL63413.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(792839..793267) GB:FROM 792839 GB:TO 793267 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63413.1 GB:DB_XREF GI:18160031 LENGTH 142 SQ:AASEQ MGVFKLIVPAVVAALVGLYLLFTAPYVKDASYFMTAPDVGMVVLTVVNPTPFPACITGVEVLKPGGVKAELHETIFNGSIAAMRPVSEVCVNPFSSLRFAHGGYHVMIMGNATGTLEIALIFKDGRRAVFTATPSRAEFHIH GT:EXON 1|1-142:0| TM:NTM 2 TM:REGION 3->25| TM:REGION 38->60| SEG 6->21|livpavvaalvglyll| BL:PDB:NREP 1 BL:PDB:REP 44->126|2k6wA|1e-06|35.8|81/120| RP:PFM:NREP 1 RP:PFM:REP 68->110|PF04314|2e-07|41.9|43/110|DUF461| HM:PFM:NREP 1 HM:PFM:REP 27->127|PF04314|2.6e-17|27.3|99/110|DUF461| RP:SCP:NREP 1 RP:SCP:REP 27->133|1x9lA|2e-10|27.6|105/149|b.2.10.1| HM:SCP:REP 3->138|1x9lA_|2e-19|25.4|134/0|b.2.10.1|1/1|DR1885-like metal-binding protein| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------111----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 57.0 SQ:SECSTR ###########################################EEEEccccccEEEEEccc##ccEEEEEEEEEEEEEEEEEEEEcccEEEcTTcEEEEcTTTEEEEEEEcTTcEEEEEEEETTTE################ DISOP:02AL 141-142| PSIPRED ccHHHHHHHHHHHHHHHEEEEEEccEEEEcccEEEcccccEEEEEEEEcccccEEEEEEEEEcccccEEEEEEEEEEccEEEEEEcccEEcccccEEEEcccccEEEEEcccccEEEEEEEEEcccEEEEEEcHHEEEEEcc //