[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63415.1
DDBJ      :             possible respiratory chain protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:177 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->112 PF06195 * DUF996 3.7e-06 21.2 80/139  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63415.1 GT:GENE AAL63415.1 GT:PRODUCT possible respiratory chain protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(794139..794672) GB:FROM 794139 GB:TO 794672 GB:DIRECTION - GB:PRODUCT possible respiratory chain protein GB:NOTE Energy metabolism; Electron transport GB:PROTEIN_ID AAL63415.1 GB:DB_XREF GI:18160033 LENGTH 177 SQ:AASEQ MSGGLERRDPSLIKVFGFIGALSFILEGLLLPVSIAAHILLLLAFRWASSYFGKISIFRKAFVWFITAVAGSIAIAATLKLTLLSLYLGGRMELWVGILWAASALPFWLLVAEMSRISKIGLFTYSGYTYAAGATAMALGAFLMPLYEALGTALIKISIFPIVYSFLLLGLALWKID GT:EXON 1|1-177:0| TM:NTM 4 TM:REGION 20->42| TM:REGION 62->84| TM:REGION 93->115| TM:REGION 143->165| SEG 72->88|siaiaatlkltllslyl| SEG 124->141|tysgytyaagatamalga| HM:PFM:NREP 1 HM:PFM:REP 33->112|PF06195|3.7e-06|21.2|80/139|DUF996| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------1-1----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //