[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63432.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   42->139 PF05573 * NosL 7e-08 35.1 %
:HMM:PFM   48->137 PF05573 * NosL 1.9e-07 28.7 87/149  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63432.1 GT:GENE AAL63432.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 808204..808818 GB:FROM 808204 GB:TO 808818 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63432.1 GB:DB_XREF GI:18160051 LENGTH 204 SQ:AASEQ MLKVSRRLFFYLLAAGGIGTVLFFATPLLQRERGGEIYCPEEPPLVYGREECPVCLMVVDYPPSSAAMRARIRGVERWYFFDDVGCLATWHKEVLRQGGEVLEICVRDRLDGKWIRGDKAVYLITTEFTAMGTGIIPAAPGNVERYKKGEVVGPWRVRSVGGVEEYSPPKPAGEVRAVVDYKCVFERFSYGPAWSTPPDWYRGC GT:EXON 1|1-204:0| RP:PFM:NREP 1 RP:PFM:REP 42->139|PF05573|7e-08|35.1|94/129|NosL| HM:PFM:NREP 1 HM:PFM:REP 48->137|PF05573|1.9e-07|28.7|87/149|NosL| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------111----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccEEEccccccEEEccccccEEEEEEEcccccHHHHccHHHEEHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccEEcccEEEEEEccccccccccccccccccHHHHccccEEccEEEcccccccccccccccccEEHHHHHHHHHHHHccccccccccHHHccc //