[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63439.1
DDBJ      :             conserved hypothetical protein part 2, authentic frameshift
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:69 amino acids
:PSIPRED
:HMM:SCOP  1->69 1s7bA_ f.39.1.1 * 3e-08 27.5 %
:RPS:PFM   1->66 PF00892 * EamA 5e-04 34.8 %
:HMM:PFM   1->66 PF00892 * EamA 8.6e-15 34.8 66/126  
:BLT:SWISS 1->69 Y1552_ARCFU 5e-07 31.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63439.1 GT:GENE AAL63439.1 GT:PRODUCT conserved hypothetical protein part 2, authentic frameshift GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 812845..813054 GB:FROM 812845 GB:TO 813054 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein part 2, authentic frameshift GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63439.1 GB:DB_XREF GI:18160059 LENGTH 69 SQ:AASEQ MGVFGTVIPYRLFSSAVTKIEGARASVIASVEPVLAALWGFLFFKEIPGLLTLTAYALISTAAVVVARK GT:EXON 1|1-69:0| BL:SWS:NREP 1 BL:SWS:REP 1->69|Y1552_ARCFU|5e-07|31.9|69/270| TM:NTM 2 TM:REGION 21->43| TM:REGION 46->67| RP:PFM:NREP 1 RP:PFM:REP 1->66|PF00892|5e-04|34.8|66/125|EamA| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF00892|8.6e-15|34.8|66/126|EamA| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF00892|IPR000620| HM:SCP:REP 1->69|1s7bA_|3e-08|27.5|69/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcc //