[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63453.1
DDBJ      :             branched-chain amino acid transport ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:234 amino acids
:PSIPRED
:BLT:PDB   1->234 1ji0A PDBj 4e-57 51.8 %
:RPS:PDB   3->233 2d3wB PDBj 4e-41 19.5 %
:RPS:SCOP  1->234 1ji0A  c.37.1.12 * 1e-48 50.0 %
:HMM:SCOP  3->235 1ji0A_ c.37.1.12 * 1e-59 35.6 %
:RPS:PFM   43->164 PF00005 * ABC_tran 2e-11 41.6 %
:HMM:PFM   42->163 PF00005 * ABC_tran 3.2e-22 36.8 117/118  
:HMM:PFM   215->233 PF12399 * BCA_ABC_TP_C 2.8e-06 47.4 19/23  
:BLT:SWISS 3->233 LIVF_SALTY 2e-59 50.0 %
:PROS 74->115|PS00041|HTH_ARAC_FAMILY_1
:PROS 136->150|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63453.1 GT:GENE AAL63453.1 GT:PRODUCT branched-chain amino acid transport ATP-binding protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(827896..828600) GB:FROM 827896 GB:TO 828600 GB:DIRECTION - GB:PRODUCT branched-chain amino acid transport ATP-binding protein GB:NOTE Transport and binding proteins; Amino acids, peptides and amines GB:PROTEIN_ID AAL63453.1 GB:DB_XREF GI:18160074 LENGTH 234 SQ:AASEQ MALRITQLSSGYGKLQVLFGLTFEVGNNSIVSLLGPNGAGKTTTLLSIMGVVKPWGGKVELGGVDVTSAPPYKKVELGLSLVPEGRRLFPEMTVEENLLMGAYTKRAREKARDSLEFVYSLFPRLKERRRQKAGTMSGGEQQMLAIARALMARPRVLLIDEPSAGLAPKVVADLFQTISQLRSEMSVLLVEQNVAVALEISDYAYVLENGRIVLQGTPSELAENQHVKRAYLGV GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 3->233|LIVF_SALTY|2e-59|50.0|230/237| PROS 74->115|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| PROS 136->150|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->234|1ji0A|4e-57|51.8|226/231| RP:PDB:NREP 1 RP:PDB:REP 3->233|2d3wB|4e-41|19.5|231/244| RP:PFM:NREP 1 RP:PFM:REP 43->164|PF00005|2e-11|41.6|113/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 42->163|PF00005|3.2e-22|36.8|117/118|ABC_tran| HM:PFM:REP 215->233|PF12399|2.8e-06|47.4|19/23|BCA_ABC_TP_C| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->234|1ji0A|1e-48|50.0|234/240|c.37.1.12| HM:SCP:REP 3->235|1ji0A_|1e-59|35.6|233/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 48059 OP:NHOMOORG 1173 OP:PATTERN UUJASJJLWVURVRWQoIWVORRc*PScjUeVIBEDEBIHIFCVaOWjLO*vd9PdOUYPPNJEX189 QXrO*bcdpprYaRXSQQP-PkAAc*QQQQQQwmnoz***W*b*r*sjugWQ***SUiDD***h*t****fWXXXtaYYQ*kjCBB9CRRLH6KGKJ--EGRKKJaKWRP6777777899AAAAHUSLSXPMUWbUltt**NML*dpnorggmdfUWMGMIOHdian***YJNHJIEINJJHImacXUofAWg*************************fu***ipspqooq**ZddedeZcaadddaZYWSXUyeZb**ZMaTfyzPP**dWRWggfgfqqttrowwyystqtpmsuqsrdcbbadbceccbbyoodceqorom*x*********j*jr***ejlg*niwq*isRM**qlbehiRcjZnnOYXZMfWUULKLLKObV***WTt****************-ot*mh*p***TC**************JMM**********TSTTTTTT*aeFTka*77667666665589BC98997999A95A6LCCEDE***************x********m********BQ**w*qums******akpMVIQlWHHGHHHHTRPcojZ**PeWwhWkubaoJfYcTUYkUbaeads*Z*KLMQGIIIJGD789998988GRFGJMLnitOvTXGRItPTWXUOPdSRSSURYTVXY4-FKRMM22-222*v**W*xryy*s*x*qr-wsqrwtyuwtx*vmoqons*****ikgkmijklllllijljjj*khioonoQ4************24HHFIFFGMMNNKJ*l*WXWaWWHLQNLSMQeOPSPPHUHPVufwxvwy***s**yyk***DBB9ACCABJeonwmonno**uvuTPNKPKLLOMDCCC55MTQPIJJJ78888778*BYD996A-ABB9EC9IIHAALAAB99AYisXWk*kpkFZO 2133aUH-ZK7BUgMFCFACKODPDOEDD8AAAIGGAEABAEE878EBHMKHQKDFH9AECDD9756623617864514563243747-DF7C9CA9878B69HH84HZezOXTeXeKIDEJVJqn8*D**q4sUuMOI9eEImVEMHGCeGA*IaQQpGf*FfMbC*Yb*cagREFIC*8CAIGsYZ*9xpGHrZffQ ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ PSIPRED cEEEEccEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHcHHHHHHHccc //