[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63475.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->117 2bwnA PDBj 5e-04 11.2 %
:RPS:SCOP  8->117 2bwnA1  c.67.1.4 * 5e-04 10.8 %
:HMM:PFM   111->151 PF04056 * Ssl1 5.2e-05 52.8 36/250  
:HMM:PFM   95->115 PF11629 * Mst1_SARAH 0.00099 38.1 21/49  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63475.1 GT:GENE AAL63475.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 845031..845528 GB:FROM 845031 GB:TO 845528 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63475.1 GB:DB_XREF GI:18160098 LENGTH 165 SQ:AASEQ MSELLDKLREKYKEEGWRRLEGLPLEAYILELFLERRPILFPATVVEKYSIFVVDFPMAMSIATKRHVENMLETTWDIVRELGLWSSSHYMSSVRLIVLSNSVEDEVRRLAERYRKIKGIRLGLHGLVRQYLVVLDLSQSMVYTHKDLKKQKGFFEELLSEQTPH GT:EXON 1|1-165:0| RP:PDB:NREP 1 RP:PDB:REP 27->117|2bwnA|5e-04|11.2|89/395| HM:PFM:NREP 2 HM:PFM:REP 111->151|PF04056|5.2e-05|52.8|36/250|Ssl1| HM:PFM:REP 95->115|PF11629|0.00099|38.1|21/49|Mst1_SARAH| RP:SCP:NREP 1 RP:SCP:REP 8->117|2bwnA1|5e-04|10.8|102/396|c.67.1.4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 61.8 SQ:SECSTR #######HTcHHHHHHHHHH######HHHHHHHHHHHHHHTccccccccccEEEEcccHH##HHHHHHHHHHHHHcEEccEEcTTTccTTccEEEEcccTTccHHHHHHHHHHHHHH################################################ DISOP:02AL 1-7, 162-165| PSIPRED cHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //