[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63484.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   47->97 2co5A PDBj 4e-04 29.4 %
:RPS:SCOP  47->97 2co5A1  a.4.5.48 * 3e-05 29.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63484.1 GT:GENE AAL63484.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(851454..851822) GB:FROM 851454 GB:TO 851822 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63484.1 GB:DB_XREF GI:18160107 LENGTH 122 SQ:AASEQ MEEELKIIKQVDEFLKAVKCDGLKLLTVIYFANRHSSWICALDVLPYGVTDPSFYALAIKLEKYGLVRRRRLDVMTFLRITDKGMKLVEMLIEMSKEPQQAPQSQAVDQNKEPPETQGGAQS GT:EXON 1|1-122:0| RP:PDB:NREP 1 RP:PDB:REP 47->97|2co5A|4e-04|29.4|51/92| RP:SCP:NREP 1 RP:SCP:REP 47->97|2co5A1|3e-05|29.4|51/89|a.4.5.48| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------1--11--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 61.5 SQ:SECSTR ######################HHHHHHHTTTEEEGGGHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEccTTccEEEEcHHHHHHHHHHHHHHHH######################### DISOP:02AL 1-3, 94-122| PSIPRED ccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEEEEccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccHHHHHccccccccccccccc //