[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63490.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   66->100 PF10805 * DUF2730 0.00092 25.7 35/106  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63490.1 GT:GENE AAL63490.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(855753..856070) GB:FROM 855753 GB:TO 856070 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63490.1 GB:DB_XREF GI:18160114 LENGTH 105 SQ:AASEQ MRLRAPFLRMVLQNSYMELELGDIVIFAEAKRRGLYAEIYMGDVGYIYEKGMWYAYDGEGRPKIITATEAERLRKLAKKLSTLPKYHVLEQLIKALASVEPRAQQ GT:EXON 1|1-105:0| HM:PFM:NREP 1 HM:PFM:REP 66->100|PF10805|0.00092|25.7|35/106|DUF2730| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 102-105| PSIPRED ccccHHHHHHHHHccccEEEEccEEEEEEccccccEEEEEEcccccEEEccEEEEEccccccEEEEcccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccc //