[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63504.1
DDBJ      :             acetyl/acyl transferase related protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  112/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->174 3fsbB PDBj 4e-20 42.5 %
:RPS:PDB   8->154 3bfpA PDBj 1e-11 15.0 %
:RPS:SCOP  3->174 1kqaA  b.81.1.3 * 3e-14 15.1 %
:HMM:SCOP  14->90 1tdtA_ b.81.1.2 * 5.5e-09 45.8 %
:HMM:SCOP  56->211 1t3dA_ b.81.1.6 * 2.1e-38 42.2 %
:HMM:PFM   59->76 PF00132 * Hexapep 7.2e-05 50.0 18/18  
:HMM:PFM   131->147 PF00132 * Hexapep 0.00011 47.1 17/18  
:HMM:PFM   145->190 PF06946 * Phage_holin_5 0.00025 37.8 45/93  
:BLT:SWISS 4->146 LPXD_GEOSF 5e-10 38.3 %
:PROS 98->126|PS00101|HEXAPEP_TRANSFERASES
:PROS 168->196|PS00101|HEXAPEP_TRANSFERASES
:REPEAT 2|56->90|92->120
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63504.1 GT:GENE AAL63504.1 GT:PRODUCT acetyl/acyl transferase related protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 864812..865492 GB:FROM 864812 GB:TO 865492 GB:DIRECTION + GB:PRODUCT acetyl/acyl transferase related protein GB:NOTE Fatty acid and phospholipid metabolism; Biosynthesis GB:PROTEIN_ID AAL63504.1 GB:DB_XREF GI:18160129 LENGTH 226 SQ:AASEQ MGYVSNKAKILAKYVSPDAYIYGPSVIGAGSFIDAAVIGYPARQKILSGFKSPDEVSNGARIGEEVIIRSGVVIYEDVEIGDRAEFGHGVLVRELTRIGRGVRIGTSAIIERDVKIGDRAWIQSMVYIPNGTVIEEDVFIGPNAVITNDKYPPSKRLAPVVIRRGAVIGANATLIAGIEVGEGAVVAAGAVVTRDVPPGVVVAGVPARVIGKAEEYMRKRAAYEQS GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 4->146|LPXD_GEOSF|5e-10|38.3|128/348| PROS 98->126|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| PROS 168->196|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| NREPEAT 1 REPEAT 2|56->90|92->120| SEG 175->207|iagievgegavvaagavvtrdvppgvvvagvpa| BL:PDB:NREP 1 BL:PDB:REP 62->174|3fsbB|4e-20|42.5|113/258| RP:PDB:NREP 1 RP:PDB:REP 8->154|3bfpA|1e-11|15.0|147/184| HM:PFM:NREP 3 HM:PFM:REP 59->76|PF00132|7.2e-05|50.0|18/18|Hexapep| HM:PFM:REP 131->147|PF00132|0.00011|47.1|17/18|Hexapep| HM:PFM:REP 145->190|PF06946|0.00025|37.8|45/93|Phage_holin_5| RP:SCP:NREP 1 RP:SCP:REP 3->174|1kqaA|3e-14|15.1|172/200|b.81.1.3| HM:SCP:REP 14->90|1tdtA_|5.5e-09|45.8|59/0|b.81.1.2|1/2|Trimeric LpxA-like enzymes| HM:SCP:REP 56->211|1t3dA_|2.1e-38|42.2|154/262|b.81.1.6|2/2|Trimeric LpxA-like enzymes| OP:NHOMO 153 OP:NHOMOORG 142 OP:PATTERN -----1----------1111111----1-1--1-1---1---111-1112-11-11-1--1---1-11 -13-1-----------------------------------1-----------1-------11------------------1-----1------1-----------1----------------------------1-31112-------1----------------1---------1----------1-11-1-------------------11------1-------------------------------------------------------------------------------------------------------1---11111111111--111----1--1-----21--21------11---1----------------------------------------------------1----1---------------------------------------------------------------------1111--------------------------1----1---11--1-211-11--1-1-----------------2--1-------111-11---------1----------1---1-------1-----------------1--1-1-----------1--------------------------------------------------------11-------------------------------------------11111--------1---1-1------------1--------1-------1--1--1-----------------------------1111-----------------------------------------------------11111111-1--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 77.0 SQ:SECSTR HHHHHHHHHHHHHHTccEEEEEcccccccEEEEcccHHHHHHHHHHTTTcccccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEccccccccccEcccEEcTTcEEcTTcHH#################################################### DISOP:02AL 3-5, 222-226| PSIPRED ccEEccccEEccEEEccccEEcccEEEccccEEEEEEEEccccEEEEEEEEccEEEccccEEcccEEEcccEEEccccEEccccEEEccEEEcccEEEccccEEcccEEEccccEEccccEEcccEEEcccEEEccccEEcccEEEcccccccccccccEEEccccEEccccEEEccEEEccccEEEcccEEEcccccccEEEccccEEEEcccHHHHHHHHcccc //