[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63515.1
DDBJ      :             conserved protein with sugar isomerase (SIS) domain
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  56/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.80.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->199 1vivA PDBj 2e-20 36.4 %
:RPS:PDB   1->183 2cvpA PDBj 1e-06 11.6 %
:RPS:SCOP  11->199 1jeoA  c.80.1.3 * 6e-13 34.5 %
:HMM:SCOP  4->200 1m3sA_ c.80.1.3 * 3.6e-38 30.4 %
:RPS:PFM   61->155 PF01380 * SIS 2e-07 37.9 %
:HMM:PFM   42->141 PF01380 * SIS 3e-19 36.0 100/131  
:BLT:SWISS 11->201 Y1940_AERPE 5e-53 53.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63515.1 GT:GENE AAL63515.1 GT:PRODUCT conserved protein with sugar isomerase (SIS) domain GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(873607..874215) GB:FROM 873607 GB:TO 874215 GB:DIRECTION - GB:PRODUCT conserved protein with sugar isomerase (SIS) domain GB:NOTE Unclassified GB:PROTEIN_ID AAL63515.1 GB:DB_XREF GI:18160141 LENGTH 202 SQ:AASEQ MLIYFKQAYLEIANFILNSLDKLKMEEIEAFVKTIEEIYHLNKKILVVGVGRSGLVGRAFAMRLRHLGARSYVLGETITPSVEEGDLVVAISGSGTTQIVVAAAEAAKKMKARVAAITSYYDSPLGRVADLVVYIPGRTKVAAMDDYFARQILGVHEPLSPLGTLFEDTAMVALDAVIAELMKRLGKNEAELAKRHANIEVP GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 11->201|Y1940_AERPE|5e-53|53.4|191/212| SEG 46->58|lvvgvgrsglvgr| SEG 100->116|vvaaaeaakkmkarvaa| BL:PDB:NREP 1 BL:PDB:REP 59->199|1vivA|2e-20|36.4|132/184| RP:PDB:NREP 1 RP:PDB:REP 1->183|2cvpA|1e-06|11.6|173/557| RP:PFM:NREP 1 RP:PFM:REP 61->155|PF01380|2e-07|37.9|95/131|SIS| HM:PFM:NREP 1 HM:PFM:REP 42->141|PF01380|3e-19|36.0|100/131|SIS| GO:PFM:NREP 2 GO:PFM GO:0005529|"GO:sugar binding"|PF01380|IPR001347| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01380|IPR001347| RP:SCP:NREP 1 RP:SCP:REP 11->199|1jeoA|6e-13|34.5|171/177|c.80.1.3| HM:SCP:REP 4->200|1m3sA_|3.6e-38|30.4|184/0|c.80.1.3|1/1|SIS domain| OP:NHOMO 115 OP:NHOMOORG 102 OP:PATTERN 111111111111111111111111--------112--------11122-1111-1111111---1--- --------------------------------------2----------11-1----------------------------------------------------1---------------------------------------------------------------------------------------1---------------1-1111-----1-11--------111111111112211121112--1--2----------------1----------------------------------------------1---11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------1-111----1---11----11------1---------------2---1--------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 100.0 SQ:SECSTR cHHHHHHHHHHHHHHHHHHHTHcHTccccTTcccccEEEEcccEEccGGGTHHHHHHHHHTGGGGTTccEEEEEcccHTTccTTcEEEEEEccccccHHHHHHHHHHHHHHHHHHccGGGGGGTEEEEEccHHHHHHHTccGGGEEEccTTccGGGcTTTGGGHHHHHHHHHHcHHHHHHHHHHTTccccccccTTHHHcHH DISOP:02AL 202-203| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccEEEEEccHHHcccccccEEEEEccccccHHHHHHHHHHHHccccEEEEEccccccHHHHccEEEEccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccc //