[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63532.1
DDBJ      :             hypothetical protein
Swiss-Prot:CREN7_PYRAE  RecName: Full=Chromatin protein Cren7;

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->51 2jtmA PDBj 8e-04 47.2 %
:RPS:PFM   7->59 PF11520 * Cren7 9e-07 45.3 %
:HMM:PFM   3->59 PF11520 * Cren7 1.7e-26 40.4 57/60  
:BLT:SWISS 1->59 CREN7_PYRAE 4e-31 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63532.1 GT:GENE AAL63532.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 886809..886988 GB:FROM 886809 GB:TO 886988 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63532.1 GB:DB_XREF GI:18160159 LENGTH 59 SQ:AASEQ MAEEILNREYEVEYEGRKYFLRPVKAWVLQPPGKPGVVVALFKLPNGKSIRKVIMRLPP GT:EXON 1|1-59:0| SW:ID CREN7_PYRAE SW:DE RecName: Full=Chromatin protein Cren7; SW:GN Name=creN7; OrderedLocusNames=PAE1516; SW:KW Complete proteome; Cytoplasm; DNA-binding; Methylation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->59|CREN7_PYRAE|4e-31|100.0|59/59| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| BL:PDB:NREP 1 BL:PDB:REP 16->51|2jtmA|8e-04|47.2|36/60| RP:PFM:NREP 1 RP:PFM:REP 7->59|PF11520|9e-07|45.3|53/59|Cren7| HM:PFM:NREP 1 HM:PFM:REP 3->59|PF11520|1.7e-26|40.4|57/60|Cren7| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 36 STR:RPRED 61.0 SQ:SECSTR ###############ccEEEEcccEEEEEccTTcccEEEEEEEcTTccEEE######## DISOP:02AL 1-3| PSIPRED cccHHccccEEEEEcccEEEEEEHEEEEEcccccccEEEEEEEccccHHHHHHHHcccc //