[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63533.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   38->96 PF04297 * UPF0122 8.5e-06 32.2 59/101  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63533.1 GT:GENE AAL63533.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(886977..887357) GB:FROM 886977 GB:TO 887357 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63533.1 GB:DB_XREF GI:18160160 LENGTH 126 SQ:AASEQ MDKVRSEELHHLVELMKLKSAVKSDYIAEFVDGIIRETYLRLRLLDVLSLPEISLNTGESKPLEEVIKTLEDMCQRYEEHLAEIKKLRERAKTPLELEIIASLEKSLERSHITTRMLINALTESRG GT:EXON 1|1-126:0| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 63->92| SEG 40->50|lrlrlldvlsl| HM:PFM:NREP 1 HM:PFM:REP 38->96|PF04297|8.5e-06|32.2|59/101|UPF0122| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------111----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 124-126| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //