[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63550.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:55 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->50 2cadA PDBj 3e-07 27.9 %
:RPS:SCOP  7->51 2bj1A1  a.43.1.3 * 3e-07 26.7 %
:HMM:SCOP  8->51 1q5vA1 a.43.1.3 * 4.8e-09 52.3 %
:HMM:PFM   11->48 PF01402 * RHH_1 1.8e-12 43.2 37/39  
:BLT:SWISS 1->47 NIKR_METKA 1e-05 40.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63550.1 GT:GENE AAL63550.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 900886..901053 GB:FROM 900886 GB:TO 901053 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63550.1 GB:DB_XREF GI:18160178 LENGTH 55 SQ:AASEQ MSKEREKMVLISFHVPRSYVEVLDELVRMGVYPSRSEAIRAALRELLGKYKPDGI GT:EXON 1|1-55:0| BL:SWS:NREP 1 BL:SWS:REP 1->47|NIKR_METKA|1e-05|40.4|47/141| RP:PDB:NREP 1 RP:PDB:REP 8->50|2cadA|3e-07|27.9|43/131| HM:PFM:NREP 1 HM:PFM:REP 11->48|PF01402|1.8e-12|43.2|37/39|RHH_1| RP:SCP:NREP 1 RP:SCP:REP 7->51|2bj1A1|3e-07|26.7|45/50|a.43.1.3| HM:SCP:REP 8->51|1q5vA1|4.8e-09|52.3|44/48|a.43.1.3|1/1|Ribbon-helix-helix| OP:NHOMO 12 OP:NHOMOORG 7 OP:PATTERN -----------------122222----------------------------------1---------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 83.6 SQ:SECSTR #####cccccccccccHHHHHHHHHHHHHHTcccHHHHHHHHHHHHccccG#### DISOP:02AL 1-6, 53-55| PSIPRED cccccccEEEEEEEccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccc //