[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63552.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->59 PF02416 * MttA_Hcf106 6.5e-18 41.7 48/53  
:HMM:PFM   59->91 PF05204 * Hom_end 1e-05 39.4 33/110  
:BLT:SWISS 23->49 TATAC_BACSU 1e-04 55.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63552.1 GT:GENE AAL63552.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(901925..902221) GB:FROM 901925 GB:TO 902221 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63552.1 GB:DB_XREF GI:18160180 LENGTH 98 SQ:AASEQ MYLFVGVQEMILILIALVIILIWGPSKLPALARGMGEAIREFRRAASGVEEHKREEKKEEIDQKIIEMARSLGISTEGKTKEQILDEINKKLAELKKS GT:EXON 1|1-98:0| BL:SWS:NREP 1 BL:SWS:REP 23->49|TATAC_BACSU|1e-04|55.6|27/62| TM:NTM 1 TM:REGION 3->25| SEG 11->22|ililialviili| SEG 50->67|eehkreekkeeidqkiie| HM:PFM:NREP 2 HM:PFM:REP 12->59|PF02416|6.5e-18|41.7|48/53|MttA_Hcf106| HM:PFM:REP 59->91|PF05204|1e-05|39.4|33/110|Hom_end| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 48-78, 96-98| PSIPRED ccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcc //