[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63556.1
DDBJ      :             transport protein, conjectural
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:368 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  9->366 1pv7A_ f.38.1.2 * 2.1e-39 30.2 %
:RPS:PFM   26->159 PF07690 * MFS_1 2e-07 29.1 %
:HMM:PFM   13->323 PF07690 * MFS_1 2.3e-37 27.8 309/353  
:BLT:SWISS 35->81 YRT3_CAEEL 4e-04 38.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63556.1 GT:GENE AAL63556.1 GT:PRODUCT transport protein, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 904382..905488 GB:FROM 904382 GB:TO 905488 GB:DIRECTION + GB:PRODUCT transport protein, conjectural GB:NOTE Transport and binding proteins; Unknown substrate GB:PROTEIN_ID AAL63556.1 GB:DB_XREF GI:18160184 LENGTH 368 SQ:AASEQ MISRGLNLFPLVLFSRGVYSLMWFFLAPVLPAILREFRVDPAYAGLLPAAFIIGAAVTQIPASYLGAVYGHDKVAGLGMLIFGVSSALLPLSPSWEWLLLLRAVGGVGAGLFFSTAGAVLIALRPRAVGSALGWYNASFNIGAFVGYYWGFVASAIGWRAAIALPGLLSAALGVLLLRGVGIKTSTSISRSALIYGLASFPFWGAVYAANNLTATWLHLFKGISEDLAGALSSAAMISGFFGGFVGRLYDRVKRKTYLLIGAPILAALGYITIPSAPLEVIPILVFLYGISFNAYITSVYTTASKRAENPASALAIINVLNMALGLHFSYAFSWLMTQWAKAPWLMLSALALLSAFSTYIVINRLKIY GT:EXON 1|1-368:0| BL:SWS:NREP 1 BL:SWS:REP 35->81|YRT3_CAEEL|4e-04|38.3|47/544| TM:NTM 10 TM:REGION 10->32| TM:REGION 43->65| TM:REGION 73->95| TM:REGION 100->122| TM:REGION 149->171| TM:REGION 195->217| TM:REGION 228->250| TM:REGION 262->284| TM:REGION 313->335| TM:REGION 343->364| SEG 85->111|ssallplspswewllllravggvgagl| SEG 160->181|aaialpgllsaalgvlllrgvg| SEG 257->271|ylligapilaalgyi| SEG 345->357|lmlsalallsafs| RP:PFM:NREP 1 RP:PFM:REP 26->159|PF07690|2e-07|29.1|134/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 13->323|PF07690|2.3e-37|27.8|309/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| HM:SCP:REP 9->366|1pv7A_|2.1e-39|30.2|358/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN ------1--111--11-1111-1---------------------------------------1----- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //