[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63576.1
DDBJ      :             NADH-ubiquinone oxidoreductase subunit
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->93 PF00420 * Oxidored_q2 1.7e-15 22.5 89/95  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63576.1 GT:GENE AAL63576.1 GT:PRODUCT NADH-ubiquinone oxidoreductase subunit GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(926011..926304) GB:FROM 926011 GB:TO 926304 GB:DIRECTION - GB:PRODUCT NADH-ubiquinone oxidoreductase subunit GB:NOTE Energy metabolism; Electron transport GB:PROTEIN_ID AAL63576.1 GB:DB_XREF GI:18160206 LENGTH 97 SQ:AASEQ MSPAVVVGLLLIVLGIYSIAVTKNLVRILISLELVTVGAFAALAPAAASNPVLAFYGVLILVMVSVSEASILAALIYRNYALTKQTDVSSITAGREP GT:EXON 1|1-97:0| TM:NTM 2 TM:REGION 13->35| TM:REGION 55->77| SEG 5->16|vvvglllivlgi| SEG 39->55|afaalapaaasnpvlaf| HM:PFM:NREP 1 HM:PFM:REP 5->93|PF00420|1.7e-15|22.5|89/95|Oxidored_q2| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 95-97| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccc //