[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63599.1
DDBJ      :             glucose-6-phosphate isomerase, conjectural
Swiss-Prot:PGMI_PYRAE   RecName: Full=Bifunctional phosphoglucose/phosphomannose isomerase;AltName: Full=Glucose-6-phosphate isomerase;         Short=GPI;         EC=5.3.1.9;AltName: Full=Phosphoglucose isomerase;         Short=PGI;AltName: Full=Mannose-6-phosphate isomerase;         EC=5.3.1.8;AltName: Full=Phosphomannose isomerase;         Short=PMI;

Homologs  Archaea  25/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.80.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->302 1tzbA PDBj e-171 100.0 %
:RPS:PDB   33->262 2df8B PDBj 5e-12 13.7 %
:RPS:SCOP  2->302 1tzbA  c.80.1.1 * e-119 100.0 %
:HMM:SCOP  2->302 1tzbA_ c.80.1.1 * 2e-43 21.3 %
:RPS:PFM   82->146 PF01380 * SIS 8e-05 40.0 %
:RPS:PFM   182->301 PF10432 * bact-PGI_C 2e-07 39.2 %
:HMM:PFM   168->302 PF10432 * bact-PGI_C 3.2e-33 37.8 135/155  
:HMM:PFM   39->122 PF01380 * SIS 5.8e-08 27.4 84/131  
:BLT:SWISS 1->302 PGMI_PYRAE e-171 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63599.1 GT:GENE AAL63599.1 GT:PRODUCT glucose-6-phosphate isomerase, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(940791..941699) GB:FROM 940791 GB:TO 941699 GB:DIRECTION - GB:PRODUCT glucose-6-phosphate isomerase, conjectural GB:NOTE Energy metabolism; Glycolysis/gluconeogenesis GB:PROTEIN_ID AAL63599.1 GB:DB_XREF GI:18160231 LENGTH 302 SQ:AASEQ MSQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ GT:EXON 1|1-302:0| SW:ID PGMI_PYRAE SW:DE RecName: Full=Bifunctional phosphoglucose/phosphomannose isomerase;AltName: Full=Glucose-6-phosphate isomerase; Short=GPI; EC=5.3.1.9;AltName: Full=Phosphoglucose isomerase; Short=PGI;AltName: Full=Mannose-6-phosphate isomerase; EC=5.3.1.8;AltName: Full=Phosphomannose isomerase; Short=PMI; SW:GN OrderedLocusNames=PAE1610; SW:KW 3D-structure; Complete proteome; Isomerase; Multifunctional enzyme. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->302|PGMI_PYRAE|e-171|100.0|302/302| GO:SWS:NREP 2 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| BL:PDB:NREP 1 BL:PDB:REP 2->302|1tzbA|e-171|100.0|301/301| RP:PDB:NREP 1 RP:PDB:REP 33->262|2df8B|5e-12|13.7|227/324| RP:PFM:NREP 2 RP:PFM:REP 82->146|PF01380|8e-05|40.0|65/131|SIS| RP:PFM:REP 182->301|PF10432|2e-07|39.2|120/156|bact-PGI_C| HM:PFM:NREP 2 HM:PFM:REP 168->302|PF10432|3.2e-33|37.8|135/155|bact-PGI_C| HM:PFM:REP 39->122|PF01380|5.8e-08|27.4|84/131|SIS| GO:PFM:NREP 2 GO:PFM GO:0005529|"GO:sugar binding"|PF01380|IPR001347| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01380|IPR001347| RP:SCP:NREP 1 RP:SCP:REP 2->302|1tzbA|e-119|100.0|301/301|c.80.1.1| HM:SCP:REP 2->302|1tzbA_|2e-43|21.3|301/0|c.80.1.1|1/1|SIS domain| OP:NHOMO 39 OP:NHOMOORG 39 OP:PATTERN 111-1-11111111111111111--------------------------------------111--1- ---1-------------------------------------------------------------------------------11-----------1-------------------------------------1--------1--------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1--1--1-------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 301 STR:RPRED 99.7 SQ:SECSTR #EEcHGGGcGGGTHHHHccHHHHHHHHHHHHHTcccccEEEEEEcTHHHHHHHHHHHHHHTTcEEEEEEHHHHHHccccccEEEEEccccccHHHHHHHHHHHTccccEEEEEcccHTccEEEEcccccccccccHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHccEEEEEEcTTHHHHHHHHHHHHHHHHccEEEEEEGGGGGTTGGGGccTTEEEEEEEccccHHHHHHHHHHHHTTcEEEEEEcccTTccGGGTTccHHHHHHHHHTTccTETccTccccHHHcc DISOP:02AL 1-3| PSIPRED ccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHHHHHHHccccccEEEEEEccccccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEccccHHHHccEEEEEcccccHHHHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHEEccccccHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcc //