[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63603.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->92 PF09756 * DDRGK 6e-05 26.4 87/188  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63603.1 GT:GENE AAL63603.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 945066..945353 GB:FROM 945066 GB:TO 945353 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63603.1 GB:DB_XREF GI:18160235 LENGTH 95 SQ:AASEQ MAKRKEEKRGPTLFDFIEVKKEEKKETPPQGVDISEELYAFIKSAKRVGKEEVVKWAKTRGVSAGDFYKALEKLLAQRRIRKKLDDEGNLVYEPG GT:EXON 1|1-95:0| SEG 18->26|evkkeekke| HM:PFM:NREP 1 HM:PFM:REP 3->92|PF09756|6e-05|26.4|87/188|DDRGK| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 21-32, 94-95| PSIPRED ccccccHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccEEEccc //