[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63621.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->72 1x57A PDBj 5e-06 41.2 %
:RPS:PDB   21->66 2awiC PDBj 2e-08 22.7 %
:RPS:SCOP  21->72 2o38A1  a.35.1.13 * 6e-08 19.2 %
:HMM:SCOP  14->72 1x57A1 a.35.1.12 * 8e-09 36.2 %
:HMM:PFM   24->60 PF01381 * HTH_3 1.7e-09 37.8 37/55  
:BLT:SWISS 1->237 Y1545_METJA 2e-56 45.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63621.1 GT:GENE AAL63621.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 960064..960777 GB:FROM 960064 GB:TO 960777 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63621.1 GB:DB_XREF GI:18160254 LENGTH 237 SQ:AASEQ MSYQHVAIYIAGDIIVSDNPGEAIKKWRLIFGLTQTAIATRLKTSPSVISDYESGRRKFPGSRFVKKFVQALIETDLERGGIVINLLERQLLKEKFWIAVLDMREFTEPVPVSNFLQAIDAEVIVSPPAGLDVHGYTIVDSVRLVLEVPSVEYVRLYGSTTQRAAIFTKVSTGRSPMIAIKSMSAVLSVKPALVVLHGIKSEAVDPLAVEIAKRGHIPLATTTMGIEKLIENLRHFK GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 1->237|Y1545_METJA|2e-56|45.5|233/241| BL:PDB:NREP 1 BL:PDB:REP 21->72|1x57A|5e-06|41.2|51/91| RP:PDB:NREP 1 RP:PDB:REP 21->66|2awiC|2e-08|22.7|44/293| HM:PFM:NREP 1 HM:PFM:REP 24->60|PF01381|1.7e-09|37.8|37/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 21->72|2o38A1|6e-08|19.2|52/89|a.35.1.13| HM:SCP:REP 14->72|1x57A1|8e-09|36.2|58/0|a.35.1.12|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 62 OP:NHOMOORG 61 OP:PATTERN 11-11111111111111111111111111111---111111111111111111111111111111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 34.2 SQ:SECSTR #########cccHHHHHHHHHHHHHHHHHHTTccHHHHHTTTTccHHHHHHHHTTcccccHHHHHHHHHHHHEEccHHH###HHHHHHHHHTc################################################################################################################################################ DISOP:02AL 1-4, 236-237| PSIPRED ccHHHHHHHEEEEEEEEccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccEEEcccccccccHHHHHHHHccEEccccccccEEEEEEEEEccEEEEEccHHHHHHHHcccccccEEEEEEccccccEEEEEcccccccccccEEEEEccccccHHHHHHHHHHHccccEEEEEccHHHHHHHHHccc //