[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63630.1
DDBJ      :             enoyl-CoA hydratase, probable
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  5/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->173 2f6qC PDBj 2e-08 32.9 %
:RPS:PDB   8->173 2a7kC PDBj 3e-19 19.4 %
:RPS:SCOP  9->230 1dubA  c.14.1.3 * 1e-21 19.5 %
:HMM:SCOP  13->173 1wdkA4 c.14.1.3 * 3.4e-24 30.0 %
:RPS:PFM   25->173 PF00378 * ECH 3e-09 31.8 %
:HMM:PFM   33->173 PF00378 * ECH 3.1e-19 27.9 140/170  
:BLT:SWISS 12->181 ECHD3_DANRE 1e-08 31.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63630.1 GT:GENE AAL63630.1 GT:PRODUCT enoyl-CoA hydratase, probable GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(965984..966694) GB:FROM 965984 GB:TO 966694 GB:DIRECTION - GB:PRODUCT enoyl-CoA hydratase, probable GB:NOTE Fatty acid and phospholipid metabolism; Degradation GB:PROTEIN_ID AAL63630.1 GB:DB_XREF GI:18160264 LENGTH 236 SQ:AASEQ MYLLVRIVIRIEPFGKYDKVVLTGEKRNAITRDVLESLLKLGCEREVIVTNEGPVFSAGLDLSVFLESKERVLEYLFTIHKLIKKFLDCDKRIIAYIKGDVYGLGVELLYFFDYVVAASEALKFSLQGINFGLFPPYTVSIGKYLFSYGHLRIMLSRDFTAGEAFRFGIVSEIGQLSPERLFSPPEHIGAFVKAKRWIMERVDEAVPYLYKLAEAATSEETRSRIKKFFAGNRGKS GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 12->181|ECHD3_DANRE|1e-08|31.1|167/289| TM:NTM 3 TM:REGION 1->21| TM:REGION 101->123| TM:REGION 127->149| BL:PDB:NREP 1 BL:PDB:REP 19->173|2f6qC|2e-08|32.9|143/236| RP:PDB:NREP 1 RP:PDB:REP 8->173|2a7kC|3e-19|19.4|165/238| RP:PFM:NREP 1 RP:PFM:REP 25->173|PF00378|3e-09|31.8|148/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 33->173|PF00378|3.1e-19|27.9|140/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 9->230|1dubA|1e-21|19.5|220/260|c.14.1.3| HM:SCP:REP 13->173|1wdkA4|3.4e-24|30.0|160/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 37 OP:NHOMOORG 23 OP:PATTERN 11----1-33333322--1111-1-------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1---------------------------------1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---1------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 232 STR:RPRED 98.3 SQ:SECSTR #TTEEEEcEEEEEETTEEEEEEcccTTccccHHHHHHHHHHHHHcEEEEEccTTccccccccHHHHHcHHHHHHHHHHHHHHHHHHHTccccEEEEEccEEETHHHHHHTTccEEEEETTcEEEEccGGGGTcccHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHTTcccEEEHHHHHHHTccHHHHHHHHHHHHGGGTcHHHHHHHHHHHHHHTTcHHHHHHHHHHHTHHc### DISOP:02AL 233-236| PSIPRED ccEEEEEEEEEEcccEEEEEEEcccccccccHHHHHHHHHHHHccEEEEEcccccEEcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccHHHccccccEEEcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccc //