[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63656.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->41 PF01253 * SUI1 0.001 21.2 33/83  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63656.1 GT:GENE AAL63656.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(987492..987899) GB:FROM 987492 GB:TO 987899 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63656.1 GB:DB_XREF GI:18160292 LENGTH 135 SQ:AASEQ MDMNSGSRQLNIKIYRNKYRRNKCIIIIKDIVNKNLSIKKIPCDKVDIYIKKLLKRNISKKIKINDIEGVYIKINEKLFGTGWLFFPRRNLLIGAAFYGKKGIVASPRLPGRTAYFIPLDIPIISVLNADIIDFY GT:EXON 1|1-135:0| HM:PFM:NREP 1 HM:PFM:REP 9->41|PF01253|0.001|21.2|33/83|SUI1| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10| PSIPRED cccccccEEEEEEEEEccccccEEEEEEEHHHccccEEEEccccHHHHHHHHHHHcccccEEEEEcccEEEEEEccEEEEcEEEEEccccEEEEEEEEcccccEEcccccccEEEEEEEcccEEEHHcccEEEcc //