[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63672.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->222 PF09973 * DUF2208 6e-29 41.6 %
:HMM:PFM   1->228 PF09973 * DUF2208 2.2e-86 45.8 225/233  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63672.1 GT:GENE AAL63672.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1000064..1000750 GB:FROM 1000064 GB:TO 1000750 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63672.1 GB:DB_XREF GI:18160309 LENGTH 228 SQ:AASEQ MRRVLITLLSILGFSAVLTFFPAEFFTVLILYFVFFFGLSIIMGLRSYRKGVVAAQEISRGRPLIEIDEKEVNKLLEKDKELINEYKRFARASFMPLLTLPIFILLATFLFPTLPPLAESGLGPVVGREAARFLSYVVVFGIFAVISMATFRPPVAPRIVRNLKVYEAGLVIDKSLGLKAPIEVTDYKINEERKFVEFKLNNQIFRIYYKDIKELDSILSKLVRRLKQ GT:EXON 1|1-228:0| TM:NTM 4 TM:REGION 4->26| TM:REGION 33->55| TM:REGION 93->115| TM:REGION 131->153| SEG 96->118|plltlpifillatflfptlppla| RP:PFM:NREP 1 RP:PFM:REP 2->222|PF09973|6e-29|41.6|219/233|DUF2208| HM:PFM:NREP 1 HM:PFM:REP 1->228|PF09973|2.2e-86|45.8|225/233|DUF2208| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 228-229| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccHHHHHHcEEEEccccccccHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHc //