[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63673.1
DDBJ      :             ribosomal protein L12
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->110 PF00428 * Ribosomal_60s 1.5e-19 44.3 88/88  
:BLT:SWISS 1->52 RL12_SULAC 2e-16 71.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63673.1 GT:GENE AAL63673.1 GT:PRODUCT ribosomal protein L12 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1000739..1001071) GB:FROM 1000739 GB:TO 1001071 GB:DIRECTION - GB:PRODUCT ribosomal protein L12 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL63673.1 GB:DB_XREF GI:18160310 LENGTH 110 SQ:AASEQ MEYIYGALLLHYAKQEINEENLARVLQAAGITPDEVRIKTLVAALKEVNIEEAIKSAAFAPVAAAPAAAAPAATAAAASAPQAKAEEKKEEEEKKGPSEEEIAGSLASLF GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 1->52|RL12_SULAC|2e-16|71.2|52/105| SEG 53->103|aiksaafapvaaapaaaapaataaaasapqakaeekkeeeekkgpseeeia| HM:PFM:NREP 1 HM:PFM:REP 16->110|PF00428|1.5e-19|44.3|88/88|Ribosomal_60s| OP:NHOMO 45 OP:NHOMOORG 44 OP:PATTERN --11-1-11111111111111111-------1-111-------11-111-1-1111111111--1111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 95-96| PSIPRED cHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHc //