[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63674.1
DDBJ      :             ribosomal protein L38
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->60 PF01781 * Ribosomal_L38e 1.2e-07 34.9 43/69  
:BLT:SWISS 1->67 RL38_AERPE 2e-11 46.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63674.1 GT:GENE AAL63674.1 GT:PRODUCT ribosomal protein L38 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1001115..1001318) GB:FROM 1001115 GB:TO 1001318 GB:DIRECTION - GB:PRODUCT ribosomal protein L38 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL63674.1 GB:DB_XREF GI:18160311 LENGTH 67 SQ:AASEQ MPKELFLLALWKQYGERAEEIRVKRYQDYVKLKARLSGYLYTIKLPPDKAEQVLSELKSKNVKIEEV GT:EXON 1|1-67:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|RL38_AERPE|2e-11|46.3|67/67| HM:PFM:NREP 1 HM:PFM:REP 18->60|PF01781|1.2e-07|34.9|43/69|Ribosomal_L38e| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN 11---------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 52-58| PSIPRED cccHHHHHHHHHHHHcEEEEEEEEEcccEEEEEEEEccEEEEEEEcccHHHHHHHHHcccccEEEEc //