[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63675.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.2
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   38->169 2ah6C PDBj 1e-16 25.8 %
:RPS:SCOP  40->169 1nogA  a.25.2.2 * 7e-18 20.8 %
:HMM:SCOP  12->182 1rtyB_ a.25.2.2 * 7.9e-25 28.7 %
:RPS:PFM   14->167 PF01923 * Cob_adeno_trans 1e-07 34.4 %
:HMM:PFM   15->169 PF01923 * Cob_adeno_trans 1.6e-23 28.7 150/162  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63675.1 GT:GENE AAL63675.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1001462..1002004) GB:FROM 1001462 GB:TO 1002004 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63675.1 GB:DB_XREF GI:18160312 LENGTH 180 SQ:AASEQ MWQYIVLIKPCLLLFTCPGDSGDTVVYWKGSARPVRKDDPVVKLYGALDTAIAYSHKAANLIPRPQARIMRLVAFSLMELGFYLATGRAEYLDTATALYRRALKLAYAAAPEGRLGSWLACASPECSAVDEARVWIRWAERRLVSLGEAPAAKLLNQLSNLAFEVMRTLPHIEYRHRNID GT:EXON 1|1-180:0| SEG 94->110|tatalyrralklayaaa| RP:PDB:NREP 1 RP:PDB:REP 38->169|2ah6C|1e-16|25.8|124/161| RP:PFM:NREP 1 RP:PFM:REP 14->167|PF01923|1e-07|34.4|151/163|Cob_adeno_trans| HM:PFM:NREP 1 HM:PFM:REP 15->169|PF01923|1.6e-23|28.7|150/162|Cob_adeno_trans| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF01923|IPR002779| GO:PFM GO:0008817|"GO:cob(I)yrinic acid a,c-diamide adenosyltransferase activity"|PF01923|IPR002779| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF01923|IPR002779| RP:SCP:NREP 1 RP:SCP:REP 40->169|1nogA|7e-18|20.8|130/149|a.25.2.2| HM:SCP:REP 12->182|1rtyB_|7.9e-25|28.7|167/180|a.25.2.2|1/1|Cobalamin adenosyltransferase-like| OP:NHOMO 10 OP:NHOMOORG 5 OP:PATTERN ------------------22222--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 87.2 SQ:SECSTR #############ccccTTTTcEEEc###ccccEccTccHHHHHHHHHHHHHHHTTccTTTTHHHHHHHHHHHHHHHHHHHHHHHccccTTccccccHHHHHHHHHHHHHHHHHHHHHEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT####### DISOP:02AL 177-180| PSIPRED ccEEEEEHHHHHHEEEcccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccc //