[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63680.1
DDBJ      :             P. aerophilum family 550 protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->170 PF03419 * Peptidase_U4 8.1e-05 22.0 109/293  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63680.1 GT:GENE AAL63680.1 GT:PRODUCT P. aerophilum family 550 protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1007099..1007626 GB:FROM 1007099 GB:TO 1007626 GB:DIRECTION + GB:PRODUCT P. aerophilum family 550 protein GB:NOTE Hypothetical; Conserved within genome GB:PROTEIN_ID AAL63680.1 GB:DB_XREF GI:18160318 LENGTH 175 SQ:AASEQ MVLKYLFFPLFVVLFSSLGILLVGWSPWVGLFVGLWYWGVVWWCIGLWHWLLGARLSARYALLLLAPAAPYLLAPLIHEATAGASFALWAWLGMSLYLVYKPLRFRRRIAAFLISLLVFWTAGGLVAVLLVAALRREIFESPYINLPALSVALLPALTAGIIAAWLALRALRKWL GT:EXON 1|1-175:0| TM:NTM 6 TM:REGION 2->24| TM:REGION 30->52| TM:REGION 56->78| TM:REGION 82->104| TM:REGION 113->134| TM:REGION 148->170| SEG 6->18|lffplfvvlfssl| SEG 51->76|llgarlsaryallllapaapyllapl| SEG 122->134|agglvavllvaal| SEG 146->159|lpalsvallpalta| SEG 163->174|aawlalralrkw| HM:PFM:NREP 1 HM:PFM:REP 47->170|PF03419|8.1e-05|22.0|109/293|Peptidase_U4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 53-53,59-60,62-62,67-67,81-81,87-87,90-90,137-137,143-144,146-146,175-176| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //