[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63681.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63681.1 GT:GENE AAL63681.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1008019..1008204 GB:FROM 1008019 GB:TO 1008204 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63681.1 GB:DB_XREF GI:18160319 LENGTH 61 SQ:AASEQ MERKIVLGLALAAEAVLMFSATYPDQKFRPLVARVQYEARWGFFFRSADTINKALGVVGWK GT:EXON 1|1-61:0| SEG 6->17|vlglalaaeavl| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEHHHHHHHHHHEEEcccccccccHHHHHEEccccccEEEEcHHHHHHHHcccccc //