[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63684.1
DDBJ      :             thioredoxin reductase (trxB)
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  897/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:327 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->281 3f8pD PDBj 7e-52 41.0 %
:RPS:PDB   10->313 2a87A PDBj 2e-46 35.2 %
:RPS:SCOP  11->163 1fl2A1  c.3.1.5 * 9e-23 27.5 %
:RPS:SCOP  179->288 1fl2A1  c.3.1.5 * 5e-08 20.2 %
:HMM:SCOP  7->312 1jnrA2 c.3.1.4 * 1.2e-43 34.3 %
:RPS:PFM   12->282 PF07992 * Pyr_redox_2 1e-19 31.9 %
:HMM:PFM   12->286 PF07992 * Pyr_redox_2 2.5e-36 31.1 196/202  
:BLT:SWISS 12->289 TRXB_STRCO 1e-50 40.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63684.1 GT:GENE AAL63684.1 GT:PRODUCT thioredoxin reductase (trxB) GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1010358..1011341 GB:FROM 1010358 GB:TO 1011341 GB:DIRECTION + GB:PRODUCT thioredoxin reductase (trxB) GB:NOTE Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism GB:PROTEIN_ID AAL63684.1 GB:DB_XREF GI:18160322 LENGTH 327 SQ:AASEQ MQMGDLMDVDYDVIIVGAGIAGLSAALYTARQRLKTLVISRDLGGQLNMTTLIENYPAIPKISGPELAKRVEQQARTFGAEIIFDEVKAVEKHGDVFVVKTEGGDEYKSLAVILAFGKTPKELGVPGESKFKNRGVSYCTICDAPFFKGQDIALISWGDLAREPVTILSSVANKFYWIYPGEKPIHDDEFIEQAKRLGKAVFVPNSEVVEIKGDTKVKSVVVKNRKTGETQELPVSAVFIEVGYVTKSDFVKHLVELNERGEIIADWEGKTKTPGVFAAGDIVAYPYKQAVISAAMGVAAALSATAYVMKLKGKPVHSLVDWRAEKK GT:EXON 1|1-327:0| BL:SWS:NREP 1 BL:SWS:REP 12->289|TRXB_STRCO|1e-50|40.6|278/322| TM:NTM 2 TM:REGION 8->30| TM:REGION 289->310| SEG 290->306|avisaamgvaaalsata| BL:PDB:NREP 1 BL:PDB:REP 11->281|3f8pD|7e-52|41.0|271/310| RP:PDB:NREP 1 RP:PDB:REP 10->313|2a87A|2e-46|35.2|304/313| RP:PFM:NREP 1 RP:PFM:REP 12->282|PF07992|1e-19|31.9|263/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 12->286|PF07992|2.5e-36|31.1|196/202|Pyr_redox_2| RP:SCP:NREP 2 RP:SCP:REP 11->163|1fl2A1|9e-23|27.5|153/184|c.3.1.5| RP:SCP:REP 179->288|1fl2A1|5e-08|20.2|108/184|c.3.1.5| HM:SCP:REP 7->312|1jnrA2|1.2e-43|34.3|245/357|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 1986 OP:NHOMOORG 1088 OP:PATTERN 11111124333333331122111135313432111111111111111111111111111112111111 2231311111121211112-12112211111122222353241231121121432121--2322122231112222222213113---222212221-1222233422121111111111111112222221122311133111223-121111111122211-11312212122222122221212211134444444444444444433553444433353443333336822233333333323332233322122121112233222224313333333233233222222222222332333333333221222222311235333333333323222332223314123244232213312221221212422311111223322223423311111111111144244111122121112131221112111221111111122222222133312221122222211222222222222221222213312112211245242211112266222212336233323232222322231322221222111111111111132211113352354431111111121114113141111111111111111111111111112222222122122222222222222222221-2111111111122221212222222222-2232222222222222223222221122222112111222222122222221111111111111111-2111111111121131111111111-11114334423222223333232232222422211111111111112111112222233334332232222111122111111111111113----1-11111111111111111112111111111111 ----111----122311111111111111111111111111111111111111111111111111111-1221112212211111121-111111111111112211131-----1-----------------------------------------------1------1----1221-111224322132111---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 95.7 SQ:SECSTR HHHHcEccccEEEEEEccHHHHHHHHHHHHHTTcccEEEccccccGGGccccccccTTcTTccHHHHHHHHHHHHHHTTcEEEcccEEEEEcccccEEEEETTccEEEEEEEEEcccEEEcccccTHHHHTcTTTEEccHHHHGGGGTTcEEEEEcccHHHHHHHHHHTTTccEEEEEcccccccccTTHHHHHHHcTTEEEEccEEEEEEEccccccEEEEEEETTcccEEEccccEEEcccEEEccTTTcTTcccTTccccccTTccccccTTEEEcGGGTccccccHHHHHHHHHHHHHHHHHHHHHHHH############## DISOP:02AL 1-7, 325-327| PSIPRED ccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEEccccEEEEEEEEEEcccccccccccccHHHccccEEEEEcccHHHccccEEEEEcccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHccccEEEEccEEEEEEEcccEEEEEEEEcccccEEEEEEEEEEEEEcccccHHHHHHHEEEccccEEEEccccccccccEEEEEEEEccccEEEEHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcc //