[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63704.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:100 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   20->87 2co5B PDBj 4e-05 20.6 %
:RPS:SCOP  26->99 1yg2A  a.4.5.61 * 7e-05 14.3 %
:HMM:SCOP  1->99 1bm9A_ a.4.5.7 * 3.4e-14 34.7 %
:RPS:PFM   20->99 PF05088 * Bac_GDH 3e-04 35.0 %
:HMM:PFM   14->69 PF03551 * PadR 3.4e-10 38.2 55/86  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63704.1 GT:GENE AAL63704.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1028951..1029253) GB:FROM 1028951 GB:TO 1029253 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63704.1 GB:DB_XREF GI:18160344 LENGTH 100 SQ:AASEQ MRAYQRFKRCIGQGNLWLYVVSILNRRGPLHGYAIIQELRRLGFNVSSVYGYVLLKRMVADGVLVEVEEGGKKLYAPSERAVENFKKALEELQTLLRQLS GT:EXON 1|1-100:0| RP:PDB:NREP 1 RP:PDB:REP 20->87|2co5B|4e-05|20.6|68/94| RP:PFM:NREP 1 RP:PFM:REP 20->99|PF05088|3e-04|35.0|80/1516|Bac_GDH| HM:PFM:NREP 1 HM:PFM:REP 14->69|PF03551|3.4e-10|38.2|55/86|PadR| RP:SCP:NREP 1 RP:SCP:REP 26->99|1yg2A|7e-05|14.3|70/169|a.4.5.61| HM:SCP:REP 1->99|1bm9A_|3.4e-14|34.7|98/0|a.4.5.7|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN --1--------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 77.0 SQ:SECSTR ###################HHHHHTTTEEEGGGHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEccTTccEEEEcHHHHHHHHHHHHHHHHHH#### DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccEEEEEccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHc //