[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63723.1
DDBJ      :             conserved protein part 2, authentic frameshift
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.80.1
:267 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  41->206 1rmgA  b.80.1.3 * 7e-04 13.6 %
:HMM:SCOP  3->168 1qjvA_ b.80.1.5 * 1.7e-13 23.6 %
:HMM:PFM   141->206 PF05048 * NosD 9.4e-17 44.8 58/61  
:HMM:PFM   207->246 PF03706 * UPF0104 0.00077 30.0 30/294  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63723.1 GT:GENE AAL63723.1 GT:PRODUCT conserved protein part 2, authentic frameshift GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1046196..1046999) GB:FROM 1046196 GB:TO 1046999 GB:DIRECTION - GB:PRODUCT conserved protein part 2, authentic frameshift GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL63723.1 GB:DB_XREF GI:18160364 LENGTH 267 SQ:AASEQ MLLRGYTFGVQIFGSLNRVAQVVLEGNMNGIIVGGAGNIIKDSVVKNNRNDGVAIYGRNNVVANCYIITNGYSVKLLEADLSELHDNYIARNERGILVDRSDDVRVYNNRVEDNVYGLFLLNLNRALIYNNSENVKIGGAKAVWSVGPAPGTNILGGGVVGGNVWISPDGRGHSQRCPPRRDVPEICETPYVIDGNNVDKAPLAYPGPASKGGAWLLLGLSLAAVLIVFIILSRRRAEVLRRRDGKNLYTVWSLGRNVCSSEEAASI GT:EXON 1|1-267:0| TM:NTM 1 TM:REGION 212->233| SEG 26->40|gnmngiivggagnii| SEG 156->162|gggvvgg| SEG 212->226|ggawlllglslaavl| SEG 234->243|rrraevlrrr| HM:PFM:NREP 2 HM:PFM:REP 141->206|PF05048|9.4e-17|44.8|58/61|NosD| HM:PFM:REP 207->246|PF03706|0.00077|30.0|30/294|UPF0104| RP:SCP:NREP 1 RP:SCP:REP 41->206|1rmgA|7e-04|13.6|154/422|b.80.1.3| HM:SCP:REP 3->168|1qjvA_|1.7e-13|23.6|157/0|b.80.1.5|1/1|Pectin lyase-like| OP:NHOMO 7 OP:NHOMOORG 5 OP:PATTERN ------------------1-------------------------1--2--12---------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 261-264| PSIPRED cEEEccEEEEEEEccccEEEEEEEEccccEEEEEccccEEEEEEEEcccccEEEEEEcccEEEEEEEEEccEEEEEEEccccEEEEEEEEccccEEEEEEccccEEEEcEEEccEEEEEEEccccccEEccEEEEEEcccccEEcccccccEEEEcccccccEEEccccccccccccccccccccccccEEEEccccEEcccccccccccccHHHHHHHHHHHHHHEEEEEEEEccccHHHHcccccEEEEEEcccHHccccHHccc //