[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63731.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.37.1
:444 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->272 2qenA PDBj 1e-08 31.8 %
:RPS:PDB   243->296 2cweA PDBj 5e-04 11.1 %
:RPS:SCOP  4->241 2fnaA2  c.37.1.20 * 1e-24 25.1 %
:RPS:SCOP  243->310 2fnaA1  a.4.5.11 * 9e-05 17.7 %
:HMM:SCOP  3->245 2fnaA2 c.37.1.20 * 4.4e-33 35.6 %
:HMM:SCOP  242->321 1r1uA_ a.4.5.5 * 4.9e-07 28.0 %
:RPS:PFM   6->200 PF01637 * Arch_ATPase 2e-19 39.0 %
:RPS:PFM   309->388 PF03008 * DUF234 1e-05 36.7 %
:HMM:PFM   5->206 PF01637 * Arch_ATPase 4.7e-31 27.5 200/234  
:HMM:PFM   309->387 PF03008 * DUF234 1.6e-14 34.2 79/100  
:HMM:PFM   247->289 PF09339 * HTH_IclR 1.1e-08 32.6 43/52  
:BLT:SWISS 5->403 Y3504_METJA 7e-55 36.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63731.1 GT:GENE AAL63731.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1052911..1054245 GB:FROM 1052911 GB:TO 1054245 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63731.1 GB:DB_XREF GI:18160373 LENGTH 444 SQ:AASEQ MESKFIDREAELQWLEEAYNSASAQLLVLYGRRRIGKTALAVRFLKGKRGIYHMCTYDSVEKNVKELLGKLADLTGLEYLRHLEPRFDVFLDVLARVSAGERVALVLDEFQYLVELDPSIPSVLQRAWDLSLSKTKVFLLLVGSSVGMIEERILSRKSPLYGRRTGSWKMGELPPGRIHELLPGWDPVDVFKAWAVVGGVPYYLSLFDANKSLEENLLRLFKKGGPLYEEPVFLLREELREPRVYVSILEAIASGRHALGEIADWAGLDRSKASKYLWVLQHLEIVRREVPVGKKRGLYYIWDNLFRFWFRFVYPNLSALEQGDVRPLQDGEALSQYFGEMFEEFIRRHSPSIFGVRLGKLIKGGVDIDLAGEIRGCRIYGEVKWSGDVDAEAVVRDLIRKAEGDVYIVIARGFKRRTANSYTLEEILDVLRRGGRIRLCDEKT GT:EXON 1|1-444:0| BL:SWS:NREP 1 BL:SWS:REP 5->403|Y3504_METJA|7e-55|36.2|384/439| BL:PDB:NREP 1 BL:PDB:REP 26->272|2qenA|1e-08|31.8|242/350| RP:PDB:NREP 1 RP:PDB:REP 243->296|2cweA|5e-04|11.1|54/191| RP:PFM:NREP 2 RP:PFM:REP 6->200|PF01637|2e-19|39.0|187/208|Arch_ATPase| RP:PFM:REP 309->388|PF03008|1e-05|36.7|79/101|DUF234| HM:PFM:NREP 3 HM:PFM:REP 5->206|PF01637|4.7e-31|27.5|200/234|Arch_ATPase| HM:PFM:REP 309->387|PF03008|1.6e-14|34.2|79/100|DUF234| HM:PFM:REP 247->289|PF09339|1.1e-08|32.6|43/52|HTH_IclR| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF01637|IPR011579| RP:SCP:NREP 2 RP:SCP:REP 4->241|2fnaA2|1e-24|25.1|227/278|c.37.1.20| RP:SCP:REP 243->310|2fnaA1|9e-05|17.7|62/73|a.4.5.11| HM:SCP:REP 3->245|2fnaA2|4.4e-33|35.6|233/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 242->321|1r1uA_|4.9e-07|28.0|75/94|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 136 OP:NHOMOORG 71 OP:PATTERN ------121111111---33-12----1-311--1-2---------14--2-1-9898613---1--- ----1-------------------------------1-----1--------------------------------222--11----1-211--------1---------------------------------1--------------------------------------------------------------------------------------------------------------------------1--1---------------------------------------------------------------2--------------------------1--2--11------1----2-1---------------------------------------------------------1------------------------------------------------------1-------11---------------------------------------------------------1------------------------1-------------1----------1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-------41321---1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 63.5 SQ:SECSTR #########################EEEEEccTTccHHHHHHHHHHHccEEEEEHHcccHHHHHHHHHHHcccHcccGGGT#ccGGGccHHHHHHHHHHHHHHcEEEETGGGGTTTTHHHHHHHHHHHH#HcTTEEE##EEEEccHHHHHHcTTcTTcTTTTcccEEEEcccccHHHHHHHHHHHHTTHHHHHHHHHTTcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEEEEETTcccccccccHHHHHH##################################################################################################################################### DISOP:02AL 441-444| PSIPRED cccccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHccccEEEEEEcHHHHHHccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHcccccccccccccEEEEccccHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHccccHHHccccccccEEEEEcHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccEEEEEEEcccEEEEEEEEEcccHHHHHHHHHHHHHHcccEEEEEEccccccccccEEEEcHHHHHHHccccccccccc //