[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63751.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:521 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   341->389 2e03A PDBj 2e-05 22.9 %
:HMM:PFM   213->280 PF04144 * SCAMP 7.5e-06 20.9 67/177  
:BLT:SWISS 107->271 ASSY_SHELP 2e-04 28.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63751.1 GT:GENE AAL63751.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1068564..1070129 GB:FROM 1068564 GB:TO 1070129 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63751.1 GB:DB_XREF GI:18160394 LENGTH 521 SQ:AASEQ MPVSKLRRITTRRTLALVLITAVALTTYIVATNLPSPDVTIKFEIYEDGKRITDIFTRSDVTAAVFIRAITPDGEVPVFVGQTRGAVHVPAAKLGPIAKNWTDIQRGRGNDPERFFTALIVSVAVVNKTSGKLILYATYFVDYPPAKIARGDTEVIYTLHIAKKRSETRGYVVKVDREEKGSPLLGYGFAALSPPYTEPPKDVWCEVVSPEIPSYICWYRKAWIGVENLTAVFPSSYFAVYNGKTYMKVPVIMAVNNFTASGSIEITISMLQTAAKFSVSAVLAVPADKGPSISLAGRSWGGELYYMGNSIFLGPTRSGWIWIYGRPVFASYDVYYEAPGWREYWGEENYFYIADIYVSNMIIISDKDFVLPAEIINFFYEGVTKQGPLTISGTALDDGKLDPGEYLYFSQLFSYYDKCGADFEVGIPVGAIIVAALTKNVQLTLATAAIKALEVSLSVEGANVYINGNIYNYGDHPDVPNDMNIAEYIVVAVGRYNYTAKDFWGNTCTYDVPAGLYIESR GT:EXON 1|1-521:0| BL:SWS:NREP 1 BL:SWS:REP 107->271|ASSY_SHELP|2e-04|28.1|139/100| TM:NTM 1 TM:REGION 14->36| SEG 6->27|lrrittrrtlalvlitavaltt| SEG 465->474|yingniynyg| RP:PDB:NREP 1 RP:PDB:REP 341->389|2e03A|2e-05|22.9|48/444| HM:PFM:NREP 1 HM:PFM:REP 213->280|PF04144|7.5e-06|20.9|67/177|SCAMP| OP:NHOMO 9 OP:NHOMOORG 6 OP:PATTERN ----12------------11-31--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 9.4 SQ:SECSTR ####################################################################################################################################################################################################################################################################################################################################################ccTTTTcTTEEEEEHHHHHHHEEEEEGGGGccHHHHHHHHccccccEEE#################################################################################################################################### DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccEEEEEEEEEcccEEEEEEEccccEEEEEEEEEcccccEEEEEEccccEEEccHHHccccccccHHHHccccccHHHHHHHHHHHHEEEEcccccEEEEEEEEEEcccHHHcccccEEEEEEEEEccccccccEEEEEccccccccEEEEcHHHcccccccccHHHHHEEccccccccccEEEEEEEEEEccccccccccEEEEcccEEEEEEEEEEEccccccEEEEEEEEHHHHcccEEEEEEEEEcccccccEEEEEEEccccEEEEEEEEEEccccEEEEEEEEcEEEEcccEEEEccccccccccEEEEEEEEEEEEEEEEEccccccccccEEEEEEEEEEcccccEEEEEEEEccccccHHHEEEHHHccccccccccccccccHHHEEEEEcccccEEEEcccccccEEEEEEEEEEEEEEEccEEEccccccccccccEEEEEEEEEccccEEEEEcccccccEEccEEEEEEEc //