[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63770.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   106->206 PF05088 * Bac_GDH 2e-05 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63770.1 GT:GENE AAL63770.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1085796..1086431) GB:FROM 1085796 GB:TO 1086431 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63770.1 GB:DB_XREF GI:18160414 LENGTH 211 SQ:AASEQ MWRLVYEGGAVRRIEEPALVVPPGHIGVKVKAFLLDDFSEWVRRRGRGPLSRWAFGVVVSGGEIGRYVVAYAENAAAQYIATNKYVYVNGNSPSALEAAPLAYVVEALSLIPRLVKIEVLGEDPRALALKKLAEVGPSRWRVALQGAVVEGGRVVALSRLVEVAGNCSLRVVDVPSRRALTTAASLKVKLDIPVKRLEEAAGGGWAIVLLD GT:EXON 1|1-211:0| SEG 67->81|yvvayaenaaaqyia| RP:PFM:NREP 1 RP:PFM:REP 106->206|PF05088|2e-05|40.4|94/1516|Bac_GDH| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 109-109,137-137,143-144,146-146,151-152,157-158,160-160,165-166,171-172,174-174,179-179| PSIPRED cEEEEEEcccEEEEcccEEEccccccEEEEEEEEHHHHHHHHHHccccccccEEEEEEEEcccEEEEEEEEEccccEEEEEcccEEEEEcccccccHHcHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHccccEEEEEEEEEEEEccEEEEEHHHHHHccccEEEEEEcccccEEEEEEEEEEEEEccHHHHHHcccccEEEEEEc //